KEGG   Acidianus hospitalis: Ahos_2271Help
Entry
Ahos_2271         CDS       T01493                                 

Definition
alpha-amylase
Orthology
K07405  
alpha-amylase [EC:3.2.1.1]
Organism
aho  Acidianus hospitalis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aho00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ahos_2271
Enzymes [BR:aho01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Ahos_2271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2059691..2061031)
Genome map
AA seq 446 aa AA seqDB search
MVDKIILGFEVHQPFRIRKDAFWNPRFRGNILERFFDMELNKEIFDRVKRKCYIPATKII
LEEIENAEDEGREVKFFFSLSGTFIEQAEKWGKDVLELFQVLSSTKKVEFLGQTYYHSIS
SLWEDKTEWKEQVREQKEIIKEYFKQEPQVFENTELLTNPQILDMVQEIGYKGIIMEGKE
STLNGKNPNFVYRRKGLTILFRNYRLSDDIAFRFSSRNWDQYPLTADKFANWVKDSPGQV
VTIFVDYETFGEHHWPESGILDFLRWLPRELNKRGVKFALPRELINESYYDIDIQGTSSW
ADINKDESSWLGNIMQWAYDEAVRRAEMPSKELGGDYLKAWKYFTTSDNYYYLFTGGGGP
AEVHNYFNAYSTPVDAFINEFYAINAFLNEELHKLGINNEPFFFIKNGKRSSVAWNKKEF
EEIIKRDGSLKDHLKYLKEWLGNEKD
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggtagacaaaataatacttggctttgaggttcaccaaccttttaggatcagaaaggat
gcgttctggaatcctaggtttagaggtaatatactagagcgattcttcgacatggaatta
aacaaggaaatctttgatcgagttaagaggaagtgttacattcccgctactaaaataatc
ttagaagaaatagagaatgcggaggacgaaggtagagaagtaaaattcttcttttcactt
tctggtacatttatagaacaagctgaaaaatggggcaaagacgtattagaacttttccaa
gttctttcatctacaaaaaaggtagaatttttaggacaaacttattaccattcgatttct
tccttatgggaagataagactgagtggaaagagcaagttagagagcagaaagagataata
aaggagtattttaaacaagagcctcaagttttcgagaatactgaactcttaactaatcct
caaatattagatatggtacaagagataggatataagggaataataatggaaggtaaggag
agtacattgaatggtaaaaaccctaattttgtgtatagaagaaaaggacttactatcctt
tttagaaattataggctaagcgacgatatagcgtttagattttcctcaaggaattgggat
caatatcctttaactgcggataaatttgcaaactgggttaaggactcccctggtcaagtt
gtcacaatatttgttgactatgaaacttttggagaacatcattggccagaatcaggaatt
ttagattttctcagatggttaccaagagagctcaataagaggggagtaaagtttgctttg
cctagagaattaataaatgaatcatattatgatatagacatacaaggaacttcctcttgg
gctgatataaataaggatgagagtagttggttaggcaatataatgcaatgggcttatgac
gaggcagtaaggagagctgaaatgccatcaaaggaactaggaggagattatttgaaagct
tggaagtattttactactagtgataattattattacttatttacaggtggaggaggtcct
gcagaagttcataattactttaatgcgtattctactcccgttgacgcatttataaatgaa
ttttatgcaataaacgcttttctcaatgaagagcttcataaacttggcataaataatgaa
cctttcttctttattaaaaacggtaaaagaagttctgtagcatggaataaaaaggaattc
gaggagataattaaaagagatgggagtttgaaagatcatttgaaatatctaaaggagtgg
ttaggaaatgaaaaggattga

DBGET integrated database retrieval system