KEGG   Aeromonas hydrophila ML09-119: AHML_00850Help
Entry
AHML_00850        CDS       T02683                                 

Definition
formamidopyrimidine/5-formyluracil/5-hydroxymethyluracil DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ahy  Aeromonas hydrophila ML09-119
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:ahy00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    AHML_00850
Enzymes [BR:ahy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     AHML_00850
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     AHML_00850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
203984..204796
Genome map
AA seq 270 aa AA seqDB search
MPELPEVEVSRQGISPWLTGIKVTRVVVRDGRLRWPVPGEIQELVDLTIHRVSRRAKYLL
LETDFGTAILHLGMSGSLRVLDIGTPAEKHDHVDIELANGKLLRLNDPRRFGALLWTREP
AEAHALLAKLGPEPLTDAFNADYLRERAKGRSTAIKTFLMDNQVVVGVGNIYANEALYAA
GIHPKRAAGNISAERLGTLVAEIKRVLAEAIRQGGTTLKDFTSADGKPGYFVQQLQVYGR
GGQPCFHCHTLLSEIRLGQRTTVFCSHCQR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattaccggaagtcgaagtcagccgccagggtatctcgccctggcttaccggc
atcaaggtcacccgagtggtggtgcgggacggccgcctgcgctggccggtgccgggggaa
atccaggagctggtggatctcaccatccaccgggtcagccgccgcgccaagtacctgctg
ctggagaccgacttcggcaccgccatcctccatctgggcatgtcgggcagcctgcgggtg
ctggacatcggcaccccggccgagaagcacgatcacgtggatatcgagctggccaacggc
aagctgctgcggctcaacgatccgcgccgcttcggcgccctgctgtggacccgcgagccg
gccgaggcgcacgcgctgctcgccaagctggggccggagccgctcaccgatgcgttcaac
gccgattacctgcgtgagcgtgccaaggggcgcagcaccgccatcaagaccttcctgatg
gacaaccaggtggtggtcggggtgggcaatatatacgccaacgaggcactctacgccgcc
ggcattcaccccaagcgggcggcgggcaatatcagtgccgagcggctgggcaccttggtg
gccgagatcaagcgggtgctggccgaagccatccggcagggcggcaccaccctcaaggat
ttcaccagcgcagacggcaagccgggctatttcgtgcagcagctgcaggtgtacgggcgg
ggcggccagccctgttttcactgtcacaccctgctcagtgaaatccggctgggacagcgt
acgaccgtgttctgttcccactgccagcgctga

DBGET integrated database retrieval system