KEGG   Aeromonas hydrophila ML09-119: AHML_01795Help
Entry
AHML_01795        CDS       T02683                                 

Definition
fatty acid desaturase family protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ahy  Aeromonas hydrophila ML09-119
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ahy01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ahy01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(400534..401652)
Genome map
AA seq 372 aa AA seqDB search
MERPPIIMTNTLLFALSGLTALIAVPWYGMTHGYDLWQWGSFLLLFCYCGISITAGYHRL
WSHKAYKAHPILQWIFAIGGALALQNSALHWSSDHRRHHRHVDDNQQDPYSAGRGFWYSH
IGWMLREYQGDTYHDYSNVRDLQNNPIVVFQHKHYLALTLATNIGIPLLLGLVHGDLLGM
LLLAGVLRMVMTHHTTFFINSLAHIWGSQPFTDRNSARDNGILAFFTFGEGYHNFHHLFE
NDYRNGIHWWQFDPTKWLIRSASWCGLTRDLRACPEERIEQARLEMQLKRAQAKLRKQDD
RELWQALLQEEYDKLNQQLQHYYASRKRLLEQRKRKALARYDQLKLQLEYRNLHDAFIAA
KRNWSRLLAGIA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggaacgccccccgatcatcatgaccaacaccttgctgtttgccctctccgggctgacc
gcactgatcgccgtgccttggtacggcatgacccatggctatgacctctggcagtggggc
agcttcctgctgctgttctgctattgcggcatctccatcaccgccggctaccaccggctc
tggtcccacaaggcctacaaggcacacccgatcctgcagtggatcttcgccatcggcggc
gccctcgccctgcaaaactcggctctgcactggtcttccgaccatcgccgccaccatcgc
cacgtggatgacaaccagcaggatccctacagcgcgggacgcggtttttggtactcccac
atcggctggatgctgcgcgaatatcagggcgacacctatcacgactacagcaatgtgcgg
gatctgcagaacaaccccatcgtcgttttccagcacaagcactatctggcgctgaccctg
gccaccaacatcggcatcccgctgctgctggggctcgtccacggcgatctgctcggcatg
ttgctgctagccggggtactgcgcatggtgatgactcatcacaccaccttcttcatcaac
tcgctggcccacatctggggcagccagcccttcaccgaccgcaacagcgcacgggacaac
ggcatcctggccttcttcaccttcggcgagggttaccacaactttcaccacctgttcgag
aacgactatcgcaacggtatccactggtggcagttcgatcccaccaagtggctgatccgc
agcgcctcctggtgcgggctgacccgggatctgcgcgcctgtccggaagagcgaatcgaa
caggccaggctggagatgcagctgaaacgggcccaggccaagctgcgcaagcaggatgac
agggagctgtggcaggccctgctgcaggaggagtacgacaagctgaaccagcagttgcag
cactactacgccagccgcaaacgcctgctggagcagcgcaagcgcaaggcgctggcccgc
tacgaccaactgaagctgcagctggagtatcgcaacctgcacgatgccttcatcgctgcc
aagcgcaactggagccgactgctggcaggtatcgcctga

DBGET integrated database retrieval system