KEGG   Aeromonas hydrophila ML09-119: AHML_10010Help
Entry
AHML_10010        CDS       T02683                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
ahy  Aeromonas hydrophila ML09-119
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ahy00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2198223..2198804
Genome map
AA seq 193 aa AA seqDB search
MASLHYKFATMNSGKSTQLIQAHFNYLERGMHPLAMTPAIDDRFGVGVISARVGLELRVE
VFSDSCDLFEMVKARHAERHIDVFIVDEAQFLTKEQVYQLARLVDEQDIPVIAYGLKTDF
RGELFPGSYHLLCLADKFEELKSICWCGNKAHMNSRVNEAGQVMRDGEQVEIGGNDRYVS
LCRKHYLEGRAFK
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgcactacaagtttgccaccatgaattcaggcaaatcgacccagctcatt
caggcgcacttcaattatctggagcggggcatgcatcccttggccatgacacccgccatc
gacgaccgcttcggggtcggggtgatcagtgcccgggtggggctggagctgagagtcgag
gtgttcagcgatagctgcgatctgttcgagatggtaaaagcccgccatgccgagcggcac
atcgacgtgttcatcgtcgatgaagcccagttcctgaccaaggagcaggtctatcagctg
gcccgcctcgtcgacgagcaggacattccggtgatcgcctacggcctcaagaccgatttt
cgcggcgagctgtttcccggctcctaccacctgctctgcctggccgacaagttcgaggag
ctgaaaagcatctgctggtgcggcaacaaggcgcacatgaactcccgggtcaatgaagcc
ggccaggtgatgcgcgatggcgagcaggtggagatcggcggcaatgatcgttatgtctcc
ctgtgccgcaaacactatctggaaggacgggccttcaaatag

DBGET integrated database retrieval system