KEGG   Aeromonas hydrophila ML09-119: AHML_13890Help
Entry
AHML_13890        CDS       T02683                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ahy  Aeromonas hydrophila ML09-119
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ahy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AHML_13890
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AHML_13890
   00620 Pyruvate metabolism
    AHML_13890
   00650 Butanoate metabolism
    AHML_13890
  Lipid metabolism
   00071 Fatty acid degradation
    AHML_13890
  Amino acid metabolism
   00350 Tyrosine metabolism
    AHML_13890
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AHML_13890
   00626 Naphthalene degradation
    AHML_13890
Enzymes [BR:ahy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AHML_13890
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     AHML_13890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3124546..3127209
Genome map
AA seq 887 aa AA seqDB search
MAVTNMAELDALVARVKEAQREFASFSQEQVDKIFRAAALAASNARIPLAQMAVEESGMG
IIEDKVIKNHFASEYIYNKYKEEKTCGILSEDDEMGTITIAEPVGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKNSTNTAAKLVLDAAIAAGAPKDIIGWIDQPTVELSNA
LMKHNDINLILATGGPGMVKAAYSSGKPAIGVGAGNVPVVIDETADVKRAVASILMSKTF
DNGVVCASEQAVIVVDSIYDQVKERFATHNGYVLTKEEADKVRKVILINGAMNANIVGQP
ATKIAEMSGVTVPPTTKILIGEGLEVCEEEEFAHEKLSPTLGMFRAKNFEEAVEMACTMV
NLGGIGHTSGLYTDQDRNADRIKYFGDKMKTARILINTPTTQGGIGDLYNFAIAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALGDLEGKKRA
LVVTDRFLFNNGYADEVVRLLKGLKMEVEVFYEVEADPTLSVVRKGAEMAHSFKPDVIVA
LGGGSPMDAAKIMWVMYEHPETAFEDLAMRFMDIRKRIYKFPKMGVKAELVCITTTSGTG
SEVTPFAVVTDDATGMKYPLADYELTPNMAIVDANLVMGMPKSLCAFGGIDAVTHAMEAY
VSVLANEYSDGQALQALKLLKEYLPSSYQNGANDPVAREKVHNAATIAGIAFANAFLGVC
HSMAHKLGAEFHIPHGLANALLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEVADHL
GLTAAGDRTAAKIEKLLVWLDELKATLGIPASIREAGVSEADFLAKVDQLAVEAFDDQCT
GANPRYPLISELKAILLDTYYGRPFTEDAQVAAKVEAKVEGKKKSKA
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaaccaacatggctgaactggatgcactggtcgcccgcgtcaaagaagcacag
cgtgaattcgccagcttctcgcaagagcaggtagacaagatcttccgtgccgccgccctg
gccgccagcaatgcccgtatccccctggcccagatggccgtggaagagtccggtatgggt
atcatcgaagacaaggttatcaagaaccacttcgcctccgaatacatctacaacaagtac
aaagaagagaagacctgcggcatcctcagtgaagatgacgagatgggcaccatcaccatc
gccgagccggtaggtatcatctgcggtatcgtaccgaccaccaacccgacctccactgcg
atcttcaaatcactgatctccctgaagacccgcaacgccatcatcttctccccgcacccc
cgtgccaagaactccaccaataccgctgccaagctggtactggatgcagccattgccgcc
ggtgcgccgaaagacatcatcggctggatcgatcaaccgaccgttgaactctccaacgcc
ctgatgaagcacaacgacatcaacctgatcctggccaccggtggcccgggcatggtgaaa
gccgcttactcctctggcaaacctgccatcggtgtgggtgccggtaacgtgcctgttgtc
atcgacgaaactgccgatgtgaagcgcgccgtcgcctccatcctgatgtccaaaaccttc
gacaacggcgtggtctgtgcctccgagcaagccgtcatcgtggttgactccatctatgac
caggtgaaagagcgtttcgcgactcacaacggttatgtgctgaccaaagaagaagctgac
aaggtccgcaaggtcatcctgatcaacggtgccatgaacgccaacatcgtgggccagcca
gccaccaagatcgccgaaatgtccggcgtgaccgtgccccccaccaccaagatcctcatc
ggtgaaggtctggaagtgtgtgaggaggaagagttcgctcacgagaagctctccccgacc
ctgggtatgttccgcgccaagaacttcgaagaagccgtcgaaatggcctgcaccatggtc
aacctgggtggtatcggccacacctccggtctgtacaccgaccaggaccgcaacgccgac
cgcatcaagtacttcggcgacaagatgaagaccgcccgtatcctgatcaacaccccgacc
acccagggtggtatcggtgacctgtacaactttgccatcgcaccgtccttgacgctgggt
tgcggttcctggggtggtaactccatctccgaaaacgtgggtcccaagcacctgatcaac
aagaagacagtcgcaaaacgagcagaaaatatgctgtggcacaaacttccgaaatccatc
tacttccgtcgtggttccctgccgatcgccctgggcgacctggaaggtaaaaaacgcgca
ctggtcgtgaccgaccgcttcctgttcaacaacggctacgccgacgaagtggttcgtctg
ctcaagggcctgaagatggaagtggaagtgttctacgaagtagaagccgacccgaccctg
tctgtagtacgcaaaggcgccgagatggcccactccttcaagccggacgtgatcgtcgcg
ctgggcggtggttcaccgatggatgcggccaagatcatgtgggtgatgtacgagcacccg
gaaaccgcgttcgaagacctggccatgcgcttcatggacatccgcaagcgtatctacaag
ttcccgaaaatgggcgtgaaggccgaactggtctgtatcaccaccacttccggtaccggt
tctgaagtgaccccgtttgcggtcgtgaccgacgacgccaccggcatgaaatacccgctg
gccgactacgagctgaccccgaacatggccatcgtcgacgccaacctggtgatgggcatg
cccaaatccctgtgtgccttcggcggtatcgatgccgtgactcacgccatggaagcctac
gtttccgtactggccaacgagtactccgacggtcaggcgctgcaagccctgaaactgctc
aaagagtacctgccgtccagctaccagaacggtgccaacgacccggttgctcgcgaaaaa
gtgcacaacgccgccaccatcgccggtatcgcgttcgccaacgccttcctgggtgtgtgc
cactccatggctcacaaactgggtgccgagttccacattccgcacggtctggccaacgcc
ctgctgatcagcaacgtgatccgctacaacgccaacgacaacccgaccaagcagactgcg
ttctcccagtacgaccgtccgcaggctcgtcgtcgctacgccgaagtggccgaccacctg
ggtctgactgccgccggtgaccgtaccgccgccaagatcgagaagctgctggtatggctg
gacgagctgaaagccaccctgggcatcccggcctccatccgtgaagccggcgtgtctgaa
gctgacttcctggccaaggttgaccagctggccgtggaagccttcgatgaccagtgcacc
ggcgccaacccgcgctacccgctgatcagcgagctgaaagccatcctgctggacacctac
tacggccgtcccttcaccgaagacgctcaggtagcggccaaggttgaagccaaggttgaa
ggcaagaagaagtccaaagcctga

DBGET integrated database retrieval system