KEGG   Aeromonas hydrophila ML09-119: AHML_13945Help
Entry
AHML_13945        CDS       T02683                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ahy  Aeromonas hydrophila ML09-119
Pathway
ahy00220  Arginine biosynthesis
ahy00250  Alanine, aspartate and glutamate metabolism
ahy00290  Valine, leucine and isoleucine biosynthesis
ahy01100  Metabolic pathways
ahy01110  Biosynthesis of secondary metabolites
ahy01130  Biosynthesis of antibiotics
ahy01210  2-Oxocarboxylic acid metabolism
ahy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ahy00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AHML_13945
   00290 Valine, leucine and isoleucine biosynthesis
    AHML_13945
   00220 Arginine biosynthesis
    AHML_13945
Enzymes [BR:ahy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     AHML_13945
    2.6.1.66  valine---pyruvate transaminase
     AHML_13945
Amino acid related enzymes [BR:ahy01007]
 Aminotransferase (transaminase)
  Class I
   AHML_13945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AGM44559
Position
3139069..3140283
Genome map
AA seq 404 aa AA seqDB search
MFTIDKSHKLDDVCYDIRGPVHKEARRLEDEGHRIIKLNIGNPAPFGFDAPEEIIKDVIL
NMPLSQGYCDSKGLFSARKAVMQYYQQKGMRKVDIDDIYIGNGASELIVMAMQALLNNGD
EMLVPSPDYPLWTAAVTLSGGHAVHYRCDEGADWYPDLDDIRARITPRTRGLVLINPNNP
TGAVYGSEFLLEVIEIARQHNLIIFADEIYDKILYDDISHTSVCTLCDDVMVVTFNGLSK
AYRACGFRQGWMVITGPKGRAKGYIEGLEMLASMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLRRQRDKAWELLNDIPGVSCVKPKGALYMFPRLDPKVYDIRDDQKMVFDLLQQEK
LLLVQGTGFNWPAPDHFRLVFLPREEELEEAIGRLARFLKGYKQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgttcactatcgacaagtcgcacaagctcgacgatgtctgctatgacatccgcggcccg
gtgcataaagaagctcgccgtctcgaagacgaaggccaccgcatcatcaagctcaacatc
ggcaacccggccccgttcggtttcgatgcgccggaagagatcatcaaggatgtgatcctc
aacatgccgctcagccagggctactgcgactccaaggggctgttctcggcccgcaaggcg
gtgatgcagtactaccagcagaaagggatgcgcaaggtcgacatcgacgacatctacatc
ggcaacggcgccagcgagctcatcgtgatggcgatgcaggcgctgctcaacaacggcgac
gagatgctggtgccctcccccgactatccgctttggactgcggcagtgaccctctccggc
ggccatgcggtgcactatcgctgcgacgaaggggccgactggtacccggatctcgacgac
atccgtgcccgcatcaccccgcgcacccgcggcctggtgctgatcaaccccaacaacccc
accggcgccgtctacggcagcgagttcctgctggaagtgatcgagatcgcccgccagcac
aacctcatcatcttcgccgacgagatctacgacaagatcctctacgacgacatctcccac
accagcgtctgcaccctgtgcgacgatgtcatggtggtgaccttcaacggcctctccaag
gcctaccgtgcctgtggcttccgccagggctggatggtcatcaccggtcccaagggccgt
gccaagggctacatcgaggggctggagatgctggcctccatgcggctctgtgccaacgta
ccgatgcagcacgccatccagaccgccctgggtggctatcagagcatcaacgagctgatc
ctgccgggcggccgcctgcgccgccagcgcgacaaggcgtgggagctgctcaacgacatc
cctggggtctcctgcgtcaagcccaagggggcgctctacatgttcccgcgcctcgacccc
aaggtgtatgacatccgcgacgaccagaagatggtgttcgatctgctgcagcaggaaaaa
ttgctgctggtgcagggcaccggcttcaactggccggcgccggatcacttccggctggtg
ttcctgccccgggaagaggagctggaagaggccatcggccgtctcgcccgcttcctcaag
ggctacaagcagtaa

DBGET integrated database retrieval system