KEGG   Aeromonas hydrophila ML09-119: AHML_15055Help
Entry
AHML_15055        CDS       T02683                                 

Definition
alkaline phosphatase, placental type
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ahy  Aeromonas hydrophila ML09-119
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ahy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AHML_15055
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    AHML_15055
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AHML_15055
Enzymes [BR:ahy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     AHML_15055
Exosome [BR:ahy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AHML_15055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3408201..3409565
Genome map
AA seq 454 aa AA seqDB search
MIGAALAAGCNSNNDSSAPAPGAKNVIFFLGDGMGLNTLTAARIYGVGEEGSLTIDTLPE
TAFIKTFSHDAQVTDSAPSMSAYMTGVKSNNGVISMDSDATQESNCSKSGGKPVTTLLEL
AKAAGRGTGVVTTTRVTHATPAATYAHLCNRDLEADIAAQLVPGGAGYNSALKEGVDVVL
GGGSSFFLPKTDKGKREDGRNLIDEMKAKGYQFAGNLDELNKAEAGKPLLGLFGSSHMKY
DLDRPASEPSLAQMTLAAIKQLKDQKQGYFLMVEGGRIDHALHDTNAKRALQDTLAFDNA
IKATLDEVKKTDPELKNTLIVVTADHDHTLVLNGYAKRTGKTTADNPGVLGLVKNYETGE
PSKDADGMPYTIIGFGNGYNRVDGPRSSVAPLDDATVSANDYHQEVVVKVGEIGNETHGG
TDVFLGAIGQGADSFHGSLDNTAVFGKVKAAAGL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcgccgccctggccgccggctgcaactccaacaacgacagcagtgcacccgcc
cccggcgccaagaacgtgatcttcttcctcggcgacggcatgggtctcaataccctgacc
gccgcccgtatctacggcgtcggtgaagagggcagcctcaccatcgataccctgccggag
acggccttcatcaagaccttctcccacgacgcccaggtgaccgactcggccccctccatg
tccgcctacatgaccggggtcaagagcaacaacggcgtcatcagcatggacagcgacgcc
acccaggagagcaactgcagcaagagcggcggcaagccggtcaccaccttgctggagctg
gccaaggccgccggccgcggcactggggtggttaccaccacccgggtgactcacgccacc
ccggccgccacctatgcccacctctgcaaccgggatctggaagccgacatcgccgcccag
ctggtgcccggcggtgccggttacaacagcgccctcaaagagggggtggacgtggtgctc
ggtggcggcagcagcttctttttgcccaagaccgacaagggcaagcgcgaggatggccgc
aacctcatcgatgagatgaaggccaagggctaccagtttgccggcaatctggacgagctg
aacaaggccgaggcgggcaagccgctgctggggctgtttggctcaagccacatgaaatat
gacctggaccgacccgccagcgagccttccctggcccagatgaccctggccgccatcaag
cagctcaaagaccagaaacagggctacttcctgatggtggaagggggccgcatcgaccac
gccctgcacgacaccaacgccaagcgagccctgcaggacaccctcgccttcgacaacgcc
atcaaggcgaccctcgacgaggtgaagaaaaccgatcccgagctgaaaaacaccctgatc
gtggtcaccgccgaccatgaccacacgctagtcctgaatggttatgccaagcgcaccggc
aagaccaccgccgacaaccccggcgtgctcgggctggtgaagaactacgaaaccggcgaa
ccgagcaaggatgccgatggcatgccctacaccatcatcggctttggcaacggctacaac
cgggtggacgggccgcgcagcagcgtagcgccgctggatgacgccaccgtctccgccaac
gactatcaccaggaggtagtggtcaaggtgggcgaaatcggcaacgagacccacggcggc
accgacgtcttcctaggcgccatcggccagggagcggatagcttccacggctcactcgac
aacaccgccgtgttcggcaaggtcaaggctgcggccgggctgtaa

DBGET integrated database retrieval system