KEGG   Aeromonas hydrophila ML09-119: AHML_17500Help
Entry
AHML_17500        CDS       T02683                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ahy  Aeromonas hydrophila ML09-119
Brite
Enzymes [BR:ahy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     AHML_17500
Secretion system [BR:ahy02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   AHML_17500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3974825..3975520)
Genome map
AA seq 231 aa AA seqDB search
MMLLGSFAASAGMDPQQLKQTIEQRLGVQVYLVDETPMPGLYMLGTAQGLLYTDARGDYV
LQGTMLDLAHDMKNLTMLGLRQQRQLALAQIGERRVQLRAEQERHRVTLFTDLACSSCRT
TLAELPVLQARGVSVQLLPVLGTFAELAEAQARWCDPRQFDALDLSDRLPETGCNEILAH
HIGLSQWLGIKALPSWVLPNGDLVRGYQSPEQLLKILDHINAPANPSSSAS
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgctgggctcttttgccgccagcgcggggatggatccccaacagttgaagcag
accatagagcaacggctcggggtacaggtctatctggtggacgagacccccatgcccggt
ctctacatgctgggcaccgcccaggggctgctctataccgatgccaggggcgactatgtg
ctgcagggcaccatgctggatctggcccacgacatgaaaaacctcaccatgctggggctg
cgtcagcagcggcaactggccctggcgcagatcggcgagcggcgggtacagctgcgggcc
gagcaggaacgccatcgtgtcaccctgttcaccgatctcgcttgcagcagctgtcgcacc
accctggcagagttgccggtcctgcaggcgaggggggtcagcgtacaactgctgccggtg
ctcggtacctttgccgagctggccgaagcgcaggcgcgctggtgcgatccccggcagttc
gacgcactggatctcagtgatcgtttgcctgagaccggctgtaatgagatccttgcccat
catatcggcctgagccagtggctcgggatcaaggcgctgccgagctgggtcctgccaaat
ggtgacctggtgcgcggttatcagagccctgaacaactgctcaagatactggatcacatc
aatgcccctgcaaatccgtcgtcgtccgcgagttga

DBGET integrated database retrieval system