KEGG   Aeromonas hydrophila ML09-119: AHML_18250Help
Entry
AHML_18250        CDS       T02683                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
ahy  Aeromonas hydrophila ML09-119
Pathway
ahy00330  Arginine and proline metabolism
ahy00332  Carbapenem biosynthesis
ahy01100  Metabolic pathways
ahy01130  Biosynthesis of antibiotics
ahy01230  Biosynthesis of amino acids
Module
ahy_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ahy00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AHML_18250
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    AHML_18250
Enzymes [BR:ahy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     AHML_18250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: AGM45416
Position
complement(4133418..4134521)
Genome map
AA seq 367 aa AA seqDB search
MENRTIVVKLGTSVLTGGSSQLNRAHMVELVRQCAALHRHGHRVVVVTSGAIAAGREHLG
HPPLAPTLPNKQMLAAVGQTQLIRVWQDLFNLYGLHIGQMLLTRADLEDRERYLNARDTL
RTLLDHRIIPVINENDAVATAEIKVGDNDNLSARAAILADADLLILLTDQKGLFTADPRT
NPDAQLIEEVQTIDDTLRKLAGDSVSGLGTGGMATKLQAADVARRAGVNVVIATGQMPEV
VGRLAKGERIGTLFPALASPLEGRKSWILAGPPPHGEVQVDQGAVAAMQEKGSSLLPKGI
VAVKGDFVRGDVVRILDPKGAELARGICRYNHLELDKLRGVHSDNIEQVLGYGYGAVAIH
RDDMVLL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacagaaccatagtcgtcaaactgggcaccagcgtgctcaccgggggatcttcc
cagctcaatcgtgcccacatggtcgagctggtcagacagtgtgcagccttgcaccgtcac
ggccacagggtcgtggtggtcacctcgggggccatcgcggccggccgtgagcatctgggc
caccctccattggcgccaaccctgcccaacaagcagatgctggcggccgtcggccagacc
cagctgatccgggtatggcaggatctgttcaacctctatgggctgcacatcggccagatg
ctgctgacccgcgccgatctggaggacagggagcgttacctcaatgcccgagacaccctg
cgtaccctgcttgatcaccgcatcatcccggtcatcaacgagaacgacgcagtggcgact
gccgaaatcaaggtaggggacaacgacaacctctccgcccgtgccgccattttggccgat
gcggatctgctgatcttgctcaccgaccagaaggggctgtttaccgccgatccccgtacc
aacccggatgcccagctcatcgaagaggtacagaccatcgacgacaccctgcgcaagctg
gcgggtgacagcgtcagcgggctcggtaccggcggtatggccaccaagctgcaggccgcc
gacgtggcgcgccgcgccggcgtcaacgtggtgatcgccaccggccagatgccggaagtg
gtcggccgtcttgccaagggcgagcgcatcggcactctgttcccggcgctggcgtcgccg
ctggaagggcgcaagagctggatcctggcagggcctcctcctcacggcgaagtacaggtg
gatcagggcgccgtggccgccatgcaggagaagggttccagcctgctgcccaagggcata
gtggcggtgaagggagatttcgtgcgtggtgacgtggtgcgcattctcgaccccaagggg
gccgagctggcgcgcggcatctgccgttacaatcacctggagctggacaagctgcgcggc
gtccattcggacaacatcgaacaggtgctgggttacggctatggtgccgtggccatccac
cgcgacgacatggtgctgctgtga

DBGET integrated database retrieval system