KEGG   Aeromonas hydrophila ML09-119: AHML_19415Help
Entry
AHML_19415        CDS       T02683                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ahy  Aeromonas hydrophila ML09-119
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahy00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AHML_19415
Enzymes [BR:ahy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     AHML_19415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4393467..4394798)
Genome map
AA seq 443 aa AA seqDB search
MFLPQEIIRKKRNGEALSTQEIQFFVQGITNNTIGEGQIAALAMAVYFKDMTMDERVALT
CAMRDSGMVLTWDHLNLGGPIVDKHSTGGVGDVVSLMLGPMVAACGGFVPMISGRGLGHT
GGTLDKLDAIPGYQTSVDNDRFLKVVKEAGVAIIGQTGDLAPADKRIYAVRDITATVESI
AMITGSILSKKLASGLEALVMDVKVGSGAFMPTFEASEELAKSIVAVANGAGCRTSALLT
DMNQVLASSAGNAVEVREAVRYLTGEYRNPRIHAVTMALCAEMLISAGLASDDGEARRKL
QAVLDNGKAAEIFGRMVTGLGGPGDFMERYDHHLPKAAIVRPVYAANSGFVTAMDTRELG
LAVVAMGGGRRAAGDKLDYAVGLTDFIRLGQSVEADKPLALIHAQTEEQFAQAASMVQAA
VKIGDTRPEALPEVYRRIGLADL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtttctgcctcaagaaattattcgcaagaagcgcaacggtgaagcgctcagtacccaa
gagattcaattcttcgttcagggcattaccaacaacaccatcggcgagggccagattgcg
gcgctggcgatggcggtctacttcaaagacatgaccatggatgagcgggttgccctgacc
tgtgccatgcgcgattccggcatggtactgacctgggaccacctcaatctgggtggcccg
atcgtcgacaagcactccaccggcggtgtgggtgacgtcgtctccctgatgctcggcccg
atggtcgccgcctgcggcggtttcgtgccgatgatctccggccgtggcctgggccacacc
ggcggtaccctcgacaagctggatgccattcccggctaccagacctcggtcgacaacgat
cgtttcctgaaagtggtgaaagaggcgggtgtcgccatcatcggtcagaccggcgatctc
gccccggccgacaagcgtatctatgcggtacgggacatcactgccaccgtcgaatccatt
gccatgatcaccggctccatcctctccaagaagctcgcctccgggctggaagcgctggtg
atggatgtgaaagtgggctccggtgccttcatgccgacctttgaagcctccgaagagctg
gccaagagcatcgttgccgtggccaacggcgccggctgccgtacttcagcactcttgacc
gacatgaaccaggtgctggcctccagcgccggcaacgcggtggaagtgcgcgaagcggtg
cgctacctgaccggtgaatatcgcaacccgcgcatccacgccgtgaccatggcgctgtgt
gccgagatgctgatctccgccggcctggccagcgatgacggcgaggcccgtcgcaaactg
caggcggtgctggacaacggcaaggcggccgagatcttcggtcgcatggtgaccggcctc
ggcggcccgggcgacttcatggagcgctacgatcaccacctgccgaaggccgccatcgtg
cgccccgtctatgctgccaacagcggtttcgtgactgccatggacacccgtgaactgggt
ctggccgtggtcgccatgggcggtggccgtcgcgctgccggtgacaaacttgattatgcg
gtcggtctgaccgactttatccgcctgggtcaaagcgtcgaggcagacaagccgctcgcc
ctgatccacgctcaaactgaagagcaatttgctcaggctgccagcatggtgcaggccgcc
gtcaagatcggtgacacccgaccagaggcgctgcccgaggtctaccgtcgcatcggtctg
gctgatttgtaa

DBGET integrated database retrieval system