KEGG   Acidaminococcus intestini: Acin_0145Help
Entry
Acin_0145         CDS       T01639                                 

Gene name
dapE
Definition
dipeptidase pepV (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ain  Acidaminococcus intestini
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ain01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ain00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
158994..160370
Genome map
AA seq 458 aa AA seqDB search
MELKESVARQKQALLKTLSEAIKIRSVQEEAKPGMPFGEGPAKCLAYMLKVCEDMGFRTK
NVDNYMGWAEIGEGDEMVAILGHLDVVPEGKGWDKDPYSGEVDDTNVYGRGAMDDKGPAI
AALYGMKAIVDAGLPLKRRIRILFGTNEETGAADMDYYLEKGGEVPVCGFTPDAEYPLIN
GEKGIVNADYTTHFTQDGEVKLVRIQGGTAYNIVPALCEAEFAAPSEEAKALVSRFNGKD
GMTVELTEGGFKVTTHGKEAHGSHPELGENAIGKLLLGIKEFPLSKGLQEAVTFLADKIG
MDPYGEKIGIGLEDEVSGKLSFNMGILEGDADHLTVKINYRYPVTKTYEDCAPKLTETFK
KAGFELTSEEHKGALYVDEKTPYVQTLLDVYHEMTGLTGGAMSIGGGTYAKAIPNIVAFG
PIFPGDTVREHLPNEFWEIEILMKNAQIYAEAMYRLAK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggaactcaaagaatccgttgctcgtcaaaaacaagcgctgctcaagaccctgtcggaa
gcaatcaagatccgcagcgtccaggaagaagctaaaccgggaatgccttttggtgaaggc
cctgccaagtgccttgcttatatgctgaaagtctgcgaagacatgggcttccgtaccaag
aacgtagataactacatgggttgggccgaaattggcgaaggtgatgaaatggtggccatc
cttggccatttggacgtcgttcctgaaggcaaaggctgggataaggatccctacagcggt
gaggttgatgacacgaatgtctatggacgcggtgccatggatgataaggggccagccatt
gcggcgctttatggcatgaaagccatcgttgatgccggcctgcccctgaaacgccgtatc
cgtatcctctttggaacaaatgaggaaaccggtgctgccgatatggattattatctcgaa
aaaggcggagaggtcccagtttgcggatttacgcccgatgcagaatatcctctcatcaac
ggggaaaaaggaatcgtcaatgccgactatacgacgcacttcacgcaggatggcgaggta
aagcttgtccgtatccaaggcggtacggcctacaatattgttcctgccctgtgtgaagcg
gaatttgctgcgcccagtgaagaagctaaagcgcttgtctcccgctttaatgggaaagac
ggaatgaccgtcgaactcacagaaggcggcttcaaggttacgacccacggtaaggaagca
cacggttcccatccggaactgggtgaaaacgcgattggcaagctgctccttggcatcaag
gagttccctctgtccaagggcctccaagaggcggtgactttccttgctgacaagattggg
atggatccttatggtgaaaagattggcattggtctggaagatgaagtgtcgggcaaactg
tccttcaacatgggtatcctggaaggagatgccgatcacctgaccgtaaagatcaactat
cggtatcctgtaacaaagacttatgaagattgtgctcccaagctgaccgaaacctttaag
aaggctggttttgaactgaccagcgaagaacacaagggtgccctctacgtagatgaaaag
accccttatgtccaaaccctgctcgatgtctatcatgaaatgacgggtcttacgggcggc
gccatgagcatcggcggcggcacctatgccaaggccattcctaatatcgttgcctttgga
cccattttcccgggtgatacggttcgtgaacatctccccaacgaattctgggaaattgag
atcctcatgaaaaatgcccagatttacgccgaagctatgtatcgtttggctaaatag

DBGET integrated database retrieval system