KEGG   Acidaminococcus intestini: Acin_0485Help
Entry
Acin_0485         CDS       T01639                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ain  Acidaminococcus intestini
Pathway
ain00040  Pentose and glucuronate interconversions
ain00052  Galactose metabolism
ain00500  Starch and sucrose metabolism
ain00520  Amino sugar and nucleotide sugar metabolism
ain01100  Metabolic pathways
ain01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ain00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Acin_0485 (galU)
   00052 Galactose metabolism
    Acin_0485 (galU)
   00500 Starch and sucrose metabolism
    Acin_0485 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Acin_0485 (galU)
Enzymes [BR:ain01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Acin_0485 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD
Motif
Other DBs
NCBI-ProteinID: AEQ21727
UniProt: G4Q929
Position
492578..493456
Genome map
AA seq 292 aa AA seqDB search
MQKVRKAVIPAAGFGTRFLPATKAMPKEMLPVVDIPTIQYIVEEIRASGIEQILIISGHA
KRAIEDHFDSSPELENHLYQAGKLEQLRQIRDISSIDIHYIRQKHMRGLGDAIYCAKDFV
DGEPFAVILGDDIVYTEGKPALRQLMDQYEATGATILGCQTVPREDVSSYGIVKGKEVDG
VDGLMKVEDMVEKPAVKDAPSRMAILGRYVITPDVFDVLSETKPGKGGEIQLTDALRVMS
HREPLYAYRFSGRRYDVGNKQGYLQAMVEYALRRDDLKDEFASYLKNIVKGL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagtgcgtaaagccgtaattccggctgctggtttcggaacccgtttcctgcca
gctacaaaagcgatgcccaaggaaatgcttcccgttgttgatattccgaccatccaatac
attgtagaggaaatccgtgcaagcgggattgaacagatccttatcatcagcggccatgca
aagcgagccattgaggaccattttgattcatctcccgaattggaaaatcatctctatcaa
gcaggaaaattggaacaactgcggcaaatccgtgatatctcaagcattgatatccattat
atccgtcaaaagcacatgcgcggcctgggagatgccatttactgtgccaaggactttgtt
gacggtgaaccttttgccgtcattttaggggatgatattgtctatacggagggaaagccg
gccctgcgtcagctcatggaccaatacgaggcgacaggagcaacaatcctgggctgtcag
accgtgccccgcgaagatgtctccagttatggcattgtaaagggcaaggaagtcgatggt
gtagatggcctcatgaaagtcgaggatatggtggaaaaaccggctgtcaaggacgcacca
agccgtatggcgattttaggtcggtatgtgattacgccggatgtatttgatgtcctttct
gaaacaaagccaggaaagggcggcgaaatccagctgactgatgcccttcgggtcatgagc
catcgtgagcccctttatgcttaccgtttttccggccgtcgctacgatgtgggcaataaa
caaggttatctccaggccatggtggaatatgccctgcgtcgggatgacctaaaagacgaa
tttgcttcctatttgaagaacatcgtcaaaggtctgtag

DBGET integrated database retrieval system