KEGG   Acidaminococcus intestini: Acin_0761Help
Entry
Acin_0761         CDS       T01639                                 

Gene name
ruvA
Definition
holliday junction DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ain  Acidaminococcus intestini
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ain03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
774549..775154
Genome map
AA seq 201 aa AA seqDB search
MIGFIKGRVDTIGSNYAFVETQGVGYRIYMNTSDLGRMVLDDKVKVYTYLAVREDALTLY
GFLSQEAYGLFTKLITVSGIGPKVAQGILSASKVDDFLLAIKNRDVKFLTKLPGIGKKTA
ERMLLELKDLTGPEGPLPESNGGFLAPEGPASALTETMEALASLGYTQNEISGVMNRIKV
TADMSAEDLLKKALQVMARRG
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgattggatttatcaaaggacgcgtcgatacgattggaagcaattatgcattcgttgaa
acccaaggtgtcggctaccgcatctacatgaacacatcggatttgggacgcatggtcctt
gatgataaggtcaaggtctatacgtaccttgccgtccgggaagatgccctgaccctttac
ggctttctttcccaggaggcctatggtctttttacaaagctcattacggtaagcggcatt
ggcccgaaggtggcacaaggaatcctttccgcgtcaaaggtggacgatttcctgcttgcc
atcaagaatcgggatgtgaaattcctgaccaagcttccaggcattggaaaaaagacggca
gaacgcatgctcttggagctaaaggacctgacgggaccagaaggcccgctgcccgaatca
aatggaggcttcctcgctccagaaggcccagcttctgccctgacggaaaccatggaggcg
cttgcttccttagggtacacccaaaatgaaatctcaggcgtcatgaaccgcatcaaggtg
acggcggacatgtcagcggaggacctgctcaaaaaggccctccaggtcatggcaaggagg
ggataa

DBGET integrated database retrieval system