KEGG   Acidaminococcus intestini: Acin_0958Help
Entry
Acin_0958         CDS       T01639                                 

Gene name
gltX1
Definition
glutamyl-tRNA synthetase (EC:6.1.1.24)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
ain  Acidaminococcus intestini
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:ain00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Acin_0958 (gltX1)
Enzymes [BR:ain01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Acin_0958 (gltX1)
Amino acid related enzymes [BR:ain01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Acin_0958 (gltX1)
Transfer RNA biogenesis [BR:ain03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Acin_0958 (gltX1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
987183..988655
Genome map
AA seq 490 aa AA seqDB search
MEKEMRVRFAPSPTGPFHIGGARSALFNWLLAKRMGGKFVLRIEDTDRKRSTPESEENIK
AALKWLGITWDEGADVGGPYGPYHQMERLDIYKKYTDQLLKEGKAYYCYCTPEELEEERQ
ALLKDCKMPRYMGKCRHLTEEQKAQYEKEGRKPSIRLKVPENETIVVHDMVRGDVEFDSN
GIGDFVIVKSDGIPTYNYAVVIDDYLMHITHVIRAEEHLSNTPRQLLVYEALGFEKPVFA
HISLILGTDHTKMSKRHGATSVDAYRQQGYLPEGIDNFLALLGWAPQGEEEIFSMEEACK
VFSMDRVAKNPAVFDIKKLNWINSQHIRKLTPDAFFELAKPFMVKAGYMTGDETGEKLDW
LKRVVATAQTQVDYGAQVPEKVALYFTDDFDFENEEAVSVLKEETVPLVMKALIEGFHSL
DELNHDSVKGVFKAVQKGNKLKGQQVYMPFRVALTGNQHGPELAEMIPLLGADRVEKRIM
KSLEKAHVSL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagaaatgagagtacgttttgcaccgagcccgactggcccgttccacatcggc
ggcgcccgttccgcacttttcaactggcttctggctaaacgcatgggcggtaaattcgta
ctgcgcattgaagatacggaccggaaacgttctacgccggaatctgaagaaaacattaag
gccgctttgaaatggcttggtatcacttgggatgaaggggcggacgtgggcggcccttat
ggcccctaccatcaaatggagcggctcgacatctataagaaatatactgaccagctgctc
aaggaagggaaggcctactattgttactgtacgccggaagagttggaggaagaacggcag
gctctcctcaaggactgcaagatgccccgctatatgggcaaatgccgccacctgacggaa
gaacaaaaggcccagtatgaaaaagagggccgcaagccttccatccggctcaaggttcct
gaaaatgaaaccatcgtcgtccatgatatggtccgcggcgatgttgaatttgattcaaat
ggcattggcgacttcgtcattgtaaaaagtgatgggattcctacctataactacgccgtg
gtcattgacgactatctgatgcatatcacccatgttatccgtgcggaagaacacctgtcc
aacacgccgcgtcagctccttgtctacgaagcccttggctttgaaaaaccggtctttgcc
catatttccctgatccttggcacagatcacacgaagatgagcaagcgtcacggtgcgacg
agtgttgacgcctatcggcagcagggatatctgccggaaggtatcgataacttcctggcc
ctccttggttgggcccctcagggtgaagaagaaatcttcagcatggaagaagcctgcaag
gtcttttccatggaccgcgtggccaaaaaccctgcagtctttgacatcaagaaactcaac
tggatcaacagccagcatatccggaaactgacgccggacgccttttttgaactggccaaa
ccctttatggtgaaagccggctacatgacgggcgacgaaacaggggaaaagcttgactgg
ctgaaacgcgttgtcgcaacggcccagactcaggtcgactacggtgcccaggtgccggaa
aaggttgccctttacttcacggatgatttcgacttcgaaaatgaagaagccgtttccgtc
ctcaaagaagaaacagtgccccttgtcatgaaagccctcatcgaaggcttccatagcctg
gatgaactgaaccacgacagcgtcaaaggggtcttcaaagcagtccagaaaggcaacaaa
ctgaaaggccagcaggtctacatgccgttccgcgtagccctcacgggaaatcagcatgga
ccggaacttgctgaaatgattcctctccttggtgctgaccgtgtggaaaaacgcatcatg
aagagccttgaaaaggcccatgtgagcctctaa

DBGET integrated database retrieval system