KEGG   Acidaminococcus intestini: Acin_1211Help
Entry
Acin_1211         CDS       T01639                                 

Definition
(GenBank) carboxylesterase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
ain  Acidaminococcus intestini
Brite
Enzymes [BR:ain01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Acin_1211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 DLH DUF915 PGAP1 Peptidase_S9 Ser_hydrolase Esterase DUF1057 Thioesterase DUF2048
Motif
Other DBs
NCBI-ProteinID: AEQ22436
UniProt: G4Q8A5
Position
complement(1259413..1260150)
Genome map
AA seq 245 aa AA seqDB search
MLQGAEPYRFPGTNDTAVLLIHGYTGSPSELRELGERLHYKGYTVQGLLLNGHGTNPEDL
DGVTYEKWTQSVKSAASALKETYGKVVLVGMSMGGLLALDCASTVPVDGVIVISTPIYLF
DWRSHFLWLAEKVTRSIPKRPRHIDAPARYDVAYHEMPLSGVREFLRLLSTVKKRTLPRV
TAPLLIIQSEADRTVRPQSAQYIYEHAASPLKRIEMLPQGKHVLTLYKERGLVYQKIDRF
LEALR
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgctccaaggcgctgagccttatcgctttcctggaaccaatgatacagcggttcttctc
attcacggctacacgggttccccgtcggagctgcgtgaactgggggaacggctgcattat
aaaggctataccgtgcagggccttcttttaaatggtcacggtacgaacccggaagacctt
gacggcgtaacctatgaaaaatggactcaatccgtgaaatccgccgccagtgccctcaag
gaaacgtacggcaaggttgttttggtggggatgagtatgggaggtcttcttgcccttgat
tgcgcttcgactgttcccgttgacggggtcatcgtcatttcaacgcccatctatctattc
gattggcgttcccatttcctttggcttgcggaaaaagtgacgcgatccattcccaagcgc
cctcgtcatatcgacgctccggcccgctatgatgtggcctatcacgagatgcccctttcc
ggtgtccgcgaattcctgcgtttgctgtcgacagtcaaaaagcgcacccttcctcgcgtg
acggctccgcttcttattattcaaagtgaagcggatcgaaccgtccgcccgcaaagcgca
cagtacatctatgaacatgcggcatctcctctaaagcggatcgagatgctcccccaagga
aagcatgtcctgaccctttataaggaacggggacttgtctatcaaaaaattgaccgtttt
ctggaggccctgcgatga

DBGET integrated database retrieval system