KEGG   Acidaminococcus intestini: Acin_1456Help
Entry
Acin_1456         CDS       T01639                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ain  Acidaminococcus intestini
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ain00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1483561..1484709)
Genome map
AA seq 382 aa AA seqDB search
MGVHPTGIALMAPKAVVEPLRLVGVRAPGANIIKQEMLAMGADAANAKGTINCSIERTDV
ILLGSRTQYRHLAHKLRANQGWFGLDEVIRDIEDYLTDHELATILADGRTLTYEKMRIMG
ILNVTPDSFYSGSRVTAGSLILKRAGKMLDDGADVLDIGGESTRPGSDPVPAEEEIRRVV
GAISEIRRAYPEAILSVDTYHAATARAALDAGADIINDVTAGTGDPDMLSVAKEKDAPLI
LMHMRGTPKTMMSADMKAYHNVVGDVMEYLLTRTEACEAMGIGRTKLMLDPGLGFAKDVS
GNLELSRGLAELTGHGIPVLVAGSRKGYIGKVLGDLPPEERLEGTMALSAAAVFAGTQMV
RVHDVKENVRLIRMLEAILSCR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgggggtccatccgactgggattgccctcatggcacccaaggcggttgtggaaccgctg
cgtcttgtcggggtacgggctcccggcgccaatatcatcaaacaggaaatgctcgccatg
ggggcggacgctgctaatgccaaaggaaccatcaactgcagtatagaacggacggatgtg
attttacttggaagccgtacccagtaccggcaccttgctcacaaactcagggccaatcag
ggatggttcggtcttgatgaagtcataagggatatcgaggactatcttacagaccatgag
ctcgcgacgatccttgcggacggacggacccttacgtatgaaaagatgcggatcatggga
atccttaatgtaacacccgattccttttattcaggatcccgtgtcacagccggttccctg
atcttgaagcgggccggaaagatgctggatgacggtgccgatgtccttgatattggcggt
gaatcgacccgccctggcagtgatcccgtaccggcagaagaagaaatccgccgtgtcgtc
ggggctatttcggaaatccgccgggcttatcctgaggccatcctttccgttgatacgtac
cacgctgcgacggcccgcgccgcccttgacgcgggagccgatatcatcaacgatgttacg
gcgggaacgggtgatcccgacatgctttccgttgccaaagaaaaagacgcgccgctcatc
ctcatgcatatgcgtggtacgcccaagaccatgatgagcgccgacatgaaggcctatcat
aacgtagtcggcgatgtcatggaatatcttttaacgcggacagaggcttgtgaagcgatg
ggaattggtcgcactaaactcatgcttgatccgggtcttggctttgccaaggatgtcagc
ggcaacctggaactgtcccgcggtcttgcggaacttacgggacacgggattccagtcctt
gttgcagggtcccgcaagggctatatcggtaaggtcctgggagaccttccgccggaagag
cgccttgaagggaccatggccctttccgcagcagctgtttttgctggcacccaaatggtt
cgcgtccacgatgtcaaggaaaatgtacggctcatccgtatgttggaggcgattctatca
tgccggtag

DBGET integrated database retrieval system