KEGG   Acidaminococcus intestini: Acin_1482Help
Entry
Acin_1482         CDS       T01639                                 

Gene name
pgk
Definition
phosphoglycerate kinase (EC:2.7.2.3)
Orthology
K00927  
phosphoglycerate kinase [EC:2.7.2.3]
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ain  Acidaminococcus intestini
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:ain01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ain01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ain00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ain00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1508038..1509963)
Genome map
AA seq 641 aa AA seqDB search
MEKKTVRDINVKGKKVLVRVDYNVPMNDKGEITDTIRIDATLPTLNYLLDQGAAIILMAH
LGRPKGKVVPSMSLKPCAEYLSQVMKKEVKFAPDCIGPEATEAARELQPGEILMLENLRF
HPEEEKNDMAFAASLASLADIYVNNGFGVSHRAHASVEGVAHYLPAVSGFLLEKEIKYLG
NAVDHPVRPFAAIVGGAKVADKIGVIRSLIEKADIILIGGGMANTFLAAQGYDLGKSLVE
KESIDVAKELIALAKEKNKKMLLPIDLEMAASFSADSEHASQTLDQLNPEWMALDIGPKT
AQLYADTLKNCKTIVWNGPMGVFEMAPFAAGTRRVAEAMADNEGITIVGGGDSAAAVKHM
GLDSRMKHVSTGGGASLEYLEGKVLPGVAALDDLRDPMVAGNWKCNKTVEEAMELAHTLM
HTTEQANCEIVLFPPFTALESVAATVEGSHLGYGSQDLFYMDQGAFTGAVSGPMIAEIGS
EYSIVGHSERRTYFGDTDAIVVKKVQACYRNGLDPVLCVGENEEERTEGRTESTILSQLL
PVLAVLTDDEARRLVVAYEPLWAIGTGKTASVEDALAVSAIIRRAVEERFNHETSRRVRV
LYGGSVTAENAHAFHQPGIDGVLVGGASLSAESFAAICNTF
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaaaccgtaagagatatcaatgtcaaagggaaaaaggtcctcgtccgcgtg
gactataacgtccctatgaatgacaagggggaaatcaccgataccattcgcatcgatgct
accctgccgacgctgaactacctcctagaccaaggggccgccatcatcttgatggcgcac
ctgggccgtccaaaagggaaggttgttccgtccatgagcctcaaaccctgcgcggaatac
ctgtcccaggtcatgaaaaaagaagtgaagtttgctccggactgcattggtcccgaagca
accgaagctgcccgtgaactgcagcccggcgaaatcctcatgctggaaaacctgcggttc
catccggaagaagaaaagaacgatatggcttttgccgcatccctggcttccttagccgac
atttatgtcaacaacggctttggtgtgtcccaccgggcccacgcttccgtagaaggggtt
gcccactatttgccggctgtatcgggtttccttctggaaaaagaaatcaagtacctcggc
aatgccgtcgatcatccggtccgtccttttgccgccatcgtcggcggtgctaaggtggca
gataagatcggtgtcatccgcagccttattgaaaaagcggatatcatccttattggcggc
gggatggccaataccttcctggctgcccaagggtacgacttgggaaaatcccttgtcgaa
aaagaaagcattgacgtggccaaagagctcatcgcccttgccaaggaaaaaaataagaag
atgctgcttccgattgaccttgaaatggcggcttctttctcggccgacagtgaacatgct
tcccagaccttggatcagctcaatccggaatggatggcccttgatattggacccaagaca
gcacagctgtatgccgataccttgaagaactgcaagaccatcgtctggaacggaccgatg
ggtgtctttgaaatggcgcctttcgctgccggtacgcgccgtgtagccgaagctatggcc
gataacgaaggcatcactatcgtcggcggcggtgacagtgcggctgctgtcaagcacatg
ggtcttgacagccggatgaagcatgtgtcgacaggcggcggtgcttcccttgaatatctt
gaagggaaggtgcttcctggcgttgctgccttggatgatctccgggaccctatggtggcc
ggaaactggaaatgtaataagaccgtggaagaggccatggaattggcccataccttgatg
cataccacggaacaggcaaattgtgaaatcgttcttttcccgccctttacggctcttgaa
tctgtagcggcaacggtggaaggatcccatctgggatatggttcccaggacctgttctac
atggatcaaggcgctttcactggcgcagtttccggcccgatgattgccgaaattggttcc
gaatattccatcgtaggccattccgaacggagaacttactttggggatacagatgcgatt
gtggtcaagaaggtccaggcctgctatcgaaatggtctcgatcctgttctctgcgttggc
gagaacgaagaggaacggacggaaggccgtacggaaagtacaatcttaagccagctccta
ccggttcttgccgtcttgactgacgacgaggcacgccgactcgtcgttgcttatgaaccg
ctctgggccattggcacgggcaagacggcatccgtagaagatgctcttgctgtcagtgcc
atcattcgccgcgccgttgaagaacggttcaatcatgaaacaagccgccgtgtccgtgtc
ctttatggcggttccgtaacggccgaaaatgcgcatgccttccatcagcctggtattgat
ggcgttcttgttggcggggccagcctctcggctgaatcctttgccgccatctgcaatacg
ttttga

DBGET integrated database retrieval system