KEGG   Acidaminococcus intestini: Acin_1482Help
Entry
Acin_1482         CDS       T01639                                 

Gene name
pgk
Definition
(RefSeq) phosphoglycerate kinase (EC:2.7.2.3)
  KO
K00927  
phosphoglycerate kinase [EC:2.7.2.3]
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ain  Acidaminococcus intestini
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ain00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acin_1482 (pgk)
   01230 Biosynthesis of amino acids
    Acin_1482 (pgk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acin_1482 (pgk)
   00051 Fructose and mannose metabolism
    Acin_1482 (pgk)
   00562 Inositol phosphate metabolism
    Acin_1482 (pgk)
Enzymes [BR:ain01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     Acin_1482 (pgk)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Acin_1482 (pgk)
Exosome [BR:ain04147]
 Exosomal proteins
  Proteins found in most exosomes
   Acin_1482 (pgk)
  Exosomal proteins of colorectal cancer cells
   Acin_1482 (pgk)
  Exosomal proteins of bladder cancer cells
   Acin_1482 (pgk)
  Exosomal proteins of melanoma cells
   Acin_1482 (pgk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1508038..1509963)
Genome map
AA seq 641 aa AA seqDB search
MEKKTVRDINVKGKKVLVRVDYNVPMNDKGEITDTIRIDATLPTLNYLLDQGAAIILMAH
LGRPKGKVVPSMSLKPCAEYLSQVMKKEVKFAPDCIGPEATEAARELQPGEILMLENLRF
HPEEEKNDMAFAASLASLADIYVNNGFGVSHRAHASVEGVAHYLPAVSGFLLEKEIKYLG
NAVDHPVRPFAAIVGGAKVADKIGVIRSLIEKADIILIGGGMANTFLAAQGYDLGKSLVE
KESIDVAKELIALAKEKNKKMLLPIDLEMAASFSADSEHASQTLDQLNPEWMALDIGPKT
AQLYADTLKNCKTIVWNGPMGVFEMAPFAAGTRRVAEAMADNEGITIVGGGDSAAAVKHM
GLDSRMKHVSTGGGASLEYLEGKVLPGVAALDDLRDPMVAGNWKCNKTVEEAMELAHTLM
HTTEQANCEIVLFPPFTALESVAATVEGSHLGYGSQDLFYMDQGAFTGAVSGPMIAEIGS
EYSIVGHSERRTYFGDTDAIVVKKVQACYRNGLDPVLCVGENEEERTEGRTESTILSQLL
PVLAVLTDDEARRLVVAYEPLWAIGTGKTASVEDALAVSAIIRRAVEERFNHETSRRVRV
LYGGSVTAENAHAFHQPGIDGVLVGGASLSAESFAAICNTF
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaaaccgtaagagatatcaatgtcaaagggaaaaaggtcctcgtccgcgtg
gactataacgtccctatgaatgacaagggggaaatcaccgataccattcgcatcgatgct
accctgccgacgctgaactacctcctagaccaaggggccgccatcatcttgatggcgcac
ctgggccgtccaaaagggaaggttgttccgtccatgagcctcaaaccctgcgcggaatac
ctgtcccaggtcatgaaaaaagaagtgaagtttgctccggactgcattggtcccgaagca
accgaagctgcccgtgaactgcagcccggcgaaatcctcatgctggaaaacctgcggttc
catccggaagaagaaaagaacgatatggcttttgccgcatccctggcttccttagccgac
atttatgtcaacaacggctttggtgtgtcccaccgggcccacgcttccgtagaaggggtt
gcccactatttgccggctgtatcgggtttccttctggaaaaagaaatcaagtacctcggc
aatgccgtcgatcatccggtccgtccttttgccgccatcgtcggcggtgctaaggtggca
gataagatcggtgtcatccgcagccttattgaaaaagcggatatcatccttattggcggc
gggatggccaataccttcctggctgcccaagggtacgacttgggaaaatcccttgtcgaa
aaagaaagcattgacgtggccaaagagctcatcgcccttgccaaggaaaaaaataagaag
atgctgcttccgattgaccttgaaatggcggcttctttctcggccgacagtgaacatgct
tcccagaccttggatcagctcaatccggaatggatggcccttgatattggacccaagaca
gcacagctgtatgccgataccttgaagaactgcaagaccatcgtctggaacggaccgatg
ggtgtctttgaaatggcgcctttcgctgccggtacgcgccgtgtagccgaagctatggcc
gataacgaaggcatcactatcgtcggcggcggtgacagtgcggctgctgtcaagcacatg
ggtcttgacagccggatgaagcatgtgtcgacaggcggcggtgcttcccttgaatatctt
gaagggaaggtgcttcctggcgttgctgccttggatgatctccgggaccctatggtggcc
ggaaactggaaatgtaataagaccgtggaagaggccatggaattggcccataccttgatg
cataccacggaacaggcaaattgtgaaatcgttcttttcccgccctttacggctcttgaa
tctgtagcggcaacggtggaaggatcccatctgggatatggttcccaggacctgttctac
atggatcaaggcgctttcactggcgcagtttccggcccgatgattgccgaaattggttcc
gaatattccatcgtaggccattccgaacggagaacttactttggggatacagatgcgatt
gtggtcaagaaggtccaggcctgctatcgaaatggtctcgatcctgttctctgcgttggc
gagaacgaagaggaacggacggaaggccgtacggaaagtacaatcttaagccagctccta
ccggttcttgccgtcttgactgacgacgaggcacgccgactcgtcgttgcttatgaaccg
ctctgggccattggcacgggcaagacggcatccgtagaagatgctcttgctgtcagtgcc
atcattcgccgcgccgttgaagaacggttcaatcatgaaacaagccgccgtgtccgtgtc
ctttatggcggttccgtaacggccgaaaatgcgcatgccttccatcagcctggtattgat
ggcgttcttgttggcggggccagcctctcggctgaatcctttgccgccatctgcaatacg
ttttga

DBGET integrated database retrieval system