KEGG   Acidaminococcus intestini: Acin_1608Help
Entry
Acin_1608         CDS       T01639                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ain  Acidaminococcus intestini
Pathway
ain00900  Terpenoid backbone biosynthesis
ain01100  Metabolic pathways
ain01110  Biosynthesis of secondary metabolites
ain01130  Biosynthesis of antibiotics
Module
ain_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ain00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Acin_1608 (dxr)
Enzymes [BR:ain01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Acin_1608 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: AEQ22823
UniProt: G4Q317
Position
complement(1633159..1634319)
Genome map
AA seq 386 aa AA seqDB search
MKGLSILGSTGSIGTQTLEVVAASPERLSVAALAAHTNDALLEAQIRKFRPHVAALSDEK
AAARLRARYDGPTEILSGEEGILACATVGEADTVLGAMVGYAGLKPILAAIAAHKNIALA
NKETLVAAGSLVMDAVKKNGVRLTPVDSEHSAIFQSLEGNDHKALKRILLTASGGPFRGK
KREELRHVTVKECMNHPTWSMGTKVTLDSSTLANKGLEVIEAHWLFEASYDQIVPIIHPQ
SIVHSLVEYQDGAVIAQLGAPDMRLPIQYALSYPERWPVHFETLDLLSCGPLTFFEPDRE
VFRALPLAIEAGRAGGIMPTVFNAANEVADDAFIKGQIPFLAMADLIEAVLSKVEPVSPL
SYETIVEADRKAREVARTLLSSMGEV
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtctatccatcttagggtcgaccgggtccattggaacccagacccttgaggtt
gtggcggcaagccctgaaaggctcagtgttgcagcccttgctgcccataccaacgatgcg
cttttggaagcgcagatccggaaatttcggccgcacgtggccgccctcagcgatgaaaag
gctgccgcaaggctgcgggcccgctatgacggacctacggaaatcctttccggtgaagaa
ggcatccttgcctgtgcgacggttggagaggcggacacagttcttggagccatggtcggt
tatgcaggcttgaagccaatccttgccgccattgcagcccataagaacatcgcccttgcc
aataaagaaacccttgttgcagccggaagccttgtcatggacgcggttaaaaaaaatggc
gtgcgcctgacccctgtcgacagtgagcacagtgccatcttccaatccttggaaggcaat
gaccacaaggccttgaaacgcatcctgcttacggcttcgggaggtcctttccgtggcaag
aaacgggaagaactaaggcacgtaaccgtcaaggaatgtatgaaccatcccacttggagc
atgggaacgaaggttacgcttgattcatcgacccttgccaataaggggcttgaggtcatc
gaagcccattggctctttgaggcttcctatgatcaaattgtgcccatcatccatccccaa
agcattgttcattccctcgtggaatatcaagacggggctgtcattgcccagcttggcgcg
cccgatatgcggctgcccatccagtatgcgctcagctatccagagcgctggcccgttcac
tttgaaaccttggaccttctttcctgtgggcccctgacgttctttgaaccggaccgggag
gtcttccgcgccctgccccttgccattgaagccggtagggcaggcggcatcatgccgaca
gttttcaatgcggcaaacgaagtggcagacgatgcctttatcaaaggacagattcctttt
cttgccatggccgacctcattgaggccgtcctcagcaaagtggaacctgtttccccatta
tcctatgaaacaatcgtggaagcagatcgtaaagcgcgggaagtggcccgcacccttctg
tcctccatgggggaggtctaa

DBGET integrated database retrieval system