KEGG   Acidaminococcus intestini: Acin_2042Help
Entry
Acin_2042         CDS       T01639                                 

Gene name
pta
Definition
phosphate acetyltransferase (EC:2.3.1.8)
Orthology
K00625  
phosphate acetyltransferase [EC:2.3.1.8]
Organism
ain  Acidaminococcus intestini
Pathway
Taurine and hypotaurine metabolism
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Class
Metabolism; Overview; Carbon metabolism [PATH:ain01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ain00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ain00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:ain00680]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:ain00430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2044876..2045889)
Genome map
AA seq 337 aa AA seqDB search
MPFIDHLKSRVKPIQKRIVLPENNSDRALKAAAIVAREGFAKIILVGDPEQLNRDAKRLG
VSFEGIEIINPATYERMDELCAYFAKRREKKGMTVDKAREIMTKDTTFFGAGLVAMGDAD
GCVSGSTRTSADVIKAGLQVIGVRPGNKTVCSGFIVLSNTNLGEGGKLVFGDCGVILDPT
AEQLADIATSCAIRARYTLGIKDVRVALLTYSTKGSGTGESVDKVQQAVEILKQRNVDFA
FDGELQADAALVPEVGERKAPGSSVAGHANVLIFPNLAAANIGYKLVERFSGATCLGPLV
QGLAKPILDLSRGCSVSDIVDVVAVCASDAILADSLK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgccttttattgatcatctgaaatctcgcgtcaaaccgattcaaaagagaatcgttctt
ccggaaaacaactctgacagagcccttaaagcagctgccattgttgctcgtgaaggattt
gccaagatcatccttgttggggatcctgaacagctgaaccgtgatgccaagagactgggt
gtctcctttgaaggcattgaaatcatcaatcctgcaacctatgaacgcatggatgagctg
tgcgcttattttgcaaaacgccgtgaaaagaagggcatgaccgttgataaagcccgcgaa
atcatgaccaaggacacgaccttctttggggctggcttggttgccatgggcgatgctgac
gggtgcgtttctggttctacccgtacttctgctgatgttatcaaggcaggtctccaggtt
atcggtgtccgtcctggcaacaagactgtttgctccggctttatcgtcctcagcaacacc
aaccttggtgaaggcggtaaactggtcttcggtgactgcggtgttatccttgacccgaca
gctgaacagcttgctgatattgctacgagctgcgccatccgtgcccgttataccctgggt
atcaaagatgtccgcgttgccctcctgacctattccacgaagggatccggcactggtgaa
tccgttgataaggttcagcaggctgttgaaatcctgaaacaaagaaatgtcgactttgct
ttcgacggtgaactccaggctgacgctgcccttgttcctgaagttggcgaaagaaaagct
cctggttccagcgtagctggccatgccaacgtcctcattttcccgaaccttgctgccgct
aacattggctacaagttggttgaacgcttcagcggcgctacctgccttgggcctctggtt
cagggtctggctaaaccaatcctcgacctgtcccgcggttgctctgtcagcgatatcgtt
gacgttgttgctgtctgcgcaagcgatgctatccttgctgacagcctgaagtaa

DBGET integrated database retrieval system