KEGG   Acidaminococcus intestini: Acin_2042Help
Entry
Acin_2042         CDS       T01639                                 

Gene name
pta
Definition
phosphate acetyltransferase (EC:2.3.1.8)
Orthology
K00625  
phosphate acetyltransferase [EC:2.3.1.8]
Organism
ain  Acidaminococcus intestini
Pathway
Taurine and hypotaurine metabolism
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:ain00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acin_2042 (pta)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Acin_2042 (pta)
   00640 Propanoate metabolism
    Acin_2042 (pta)
  Energy metabolism
   00680 Methane metabolism
    Acin_2042 (pta)
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Acin_2042 (pta)
Enzymes [BR:ain01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.8  phosphate acetyltransferase
     Acin_2042 (pta)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2044876..2045889)
Genome map
AA seq 337 aa AA seqDB search
MPFIDHLKSRVKPIQKRIVLPENNSDRALKAAAIVAREGFAKIILVGDPEQLNRDAKRLG
VSFEGIEIINPATYERMDELCAYFAKRREKKGMTVDKAREIMTKDTTFFGAGLVAMGDAD
GCVSGSTRTSADVIKAGLQVIGVRPGNKTVCSGFIVLSNTNLGEGGKLVFGDCGVILDPT
AEQLADIATSCAIRARYTLGIKDVRVALLTYSTKGSGTGESVDKVQQAVEILKQRNVDFA
FDGELQADAALVPEVGERKAPGSSVAGHANVLIFPNLAAANIGYKLVERFSGATCLGPLV
QGLAKPILDLSRGCSVSDIVDVVAVCASDAILADSLK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgccttttattgatcatctgaaatctcgcgtcaaaccgattcaaaagagaatcgttctt
ccggaaaacaactctgacagagcccttaaagcagctgccattgttgctcgtgaaggattt
gccaagatcatccttgttggggatcctgaacagctgaaccgtgatgccaagagactgggt
gtctcctttgaaggcattgaaatcatcaatcctgcaacctatgaacgcatggatgagctg
tgcgcttattttgcaaaacgccgtgaaaagaagggcatgaccgttgataaagcccgcgaa
atcatgaccaaggacacgaccttctttggggctggcttggttgccatgggcgatgctgac
gggtgcgtttctggttctacccgtacttctgctgatgttatcaaggcaggtctccaggtt
atcggtgtccgtcctggcaacaagactgtttgctccggctttatcgtcctcagcaacacc
aaccttggtgaaggcggtaaactggtcttcggtgactgcggtgttatccttgacccgaca
gctgaacagcttgctgatattgctacgagctgcgccatccgtgcccgttataccctgggt
atcaaagatgtccgcgttgccctcctgacctattccacgaagggatccggcactggtgaa
tccgttgataaggttcagcaggctgttgaaatcctgaaacaaagaaatgtcgactttgct
ttcgacggtgaactccaggctgacgctgcccttgttcctgaagttggcgaaagaaaagct
cctggttccagcgtagctggccatgccaacgtcctcattttcccgaaccttgctgccgct
aacattggctacaagttggttgaacgcttcagcggcgctacctgccttgggcctctggtt
cagggtctggctaaaccaatcctcgacctgtcccgcggttgctctgtcagcgatatcgtt
gacgttgttgctgtctgcgcaagcgatgctatccttgctgacagcctgaagtaa

DBGET integrated database retrieval system