KEGG   Acidaminococcus intestini: Acin_2042Help
Entry
Acin_2042         CDS       T01639                                 

Gene name
pta
Definition
(GenBank) phosphate acetyltransferase
  KO
K00625  phosphate acetyltransferase [EC:2.3.1.8]
Organism
ain  Acidaminococcus intestini
Pathway
ain00430  Taurine and hypotaurine metabolism
ain00620  Pyruvate metabolism
ain00640  Propanoate metabolism
ain00680  Methane metabolism
ain01100  Metabolic pathways
ain01120  Microbial metabolism in diverse environments
ain01200  Carbon metabolism
Module
ain_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:ain00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Acin_2042 (pta)
   00640 Propanoate metabolism
    Acin_2042 (pta)
  Energy metabolism
   00680 Methane metabolism
    Acin_2042 (pta)
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Acin_2042 (pta)
Enzymes [BR:ain01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.8  phosphate acetyltransferase
     Acin_2042 (pta)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB
Motif
Other DBs
NCBI-ProteinID: AEQ23247
UniProt: G4Q4Z2
Position
complement(2044876..2045889)
Genome map
AA seq 337 aa AA seqDB search
MPFIDHLKSRVKPIQKRIVLPENNSDRALKAAAIVAREGFAKIILVGDPEQLNRDAKRLG
VSFEGIEIINPATYERMDELCAYFAKRREKKGMTVDKAREIMTKDTTFFGAGLVAMGDAD
GCVSGSTRTSADVIKAGLQVIGVRPGNKTVCSGFIVLSNTNLGEGGKLVFGDCGVILDPT
AEQLADIATSCAIRARYTLGIKDVRVALLTYSTKGSGTGESVDKVQQAVEILKQRNVDFA
FDGELQADAALVPEVGERKAPGSSVAGHANVLIFPNLAAANIGYKLVERFSGATCLGPLV
QGLAKPILDLSRGCSVSDIVDVVAVCASDAILADSLK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgccttttattgatcatctgaaatctcgcgtcaaaccgattcaaaagagaatcgttctt
ccggaaaacaactctgacagagcccttaaagcagctgccattgttgctcgtgaaggattt
gccaagatcatccttgttggggatcctgaacagctgaaccgtgatgccaagagactgggt
gtctcctttgaaggcattgaaatcatcaatcctgcaacctatgaacgcatggatgagctg
tgcgcttattttgcaaaacgccgtgaaaagaagggcatgaccgttgataaagcccgcgaa
atcatgaccaaggacacgaccttctttggggctggcttggttgccatgggcgatgctgac
gggtgcgtttctggttctacccgtacttctgctgatgttatcaaggcaggtctccaggtt
atcggtgtccgtcctggcaacaagactgtttgctccggctttatcgtcctcagcaacacc
aaccttggtgaaggcggtaaactggtcttcggtgactgcggtgttatccttgacccgaca
gctgaacagcttgctgatattgctacgagctgcgccatccgtgcccgttataccctgggt
atcaaagatgtccgcgttgccctcctgacctattccacgaagggatccggcactggtgaa
tccgttgataaggttcagcaggctgttgaaatcctgaaacaaagaaatgtcgactttgct
ttcgacggtgaactccaggctgacgctgcccttgttcctgaagttggcgaaagaaaagct
cctggttccagcgtagctggccatgccaacgtcctcattttcccgaaccttgctgccgct
aacattggctacaagttggttgaacgcttcagcggcgctacctgccttgggcctctggtt
cagggtctggctaaaccaatcctcgacctgtcccgcggttgctctgtcagcgatatcgtt
gacgttgttgctgtctgcgcaagcgatgctatccttgctgacagcctgaagtaa

DBGET integrated database retrieval system