KEGG   Acidaminococcus intestini: Acin_2186Help
Entry
Acin_2186         CDS       T01639                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ain  Acidaminococcus intestini
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ain00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Acin_2186 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acin_2186 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Acin_2186 (trpA)
Enzymes [BR:ain01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Acin_2186 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2209413..2210186)
Genome map
AA seq 257 aa AA seqDB search
MTRLTDAFKNKKAFIPFVTAGDPDLSTTEALIYAMEEAGASVIELGIPFSDPVAEGPVIQ
EADNRALAAGFRIDALFDLLEKVREKTEIPLVFLTYANPIFTYGREAFFTRCAKASIDGV
IVPDVPFEERATLLPFAREKGIALISLIAPTSHERVQMLAREAEGYIYLVSSMGVTGVRE
KITTDLKEIVEKIREVSNQPVAVGFGIARPEQAAQMADISDGAIVGSAIVKLVAKYGKTA
VGPVRDYVLSMVEAVRV
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgactagactaaccgatgcattcaagaataaaaaagccttcattccttttgtgaccgcc
ggtgacccggacctatccacgacggaagccctcatttatgccatggaagaagcaggggcc
agtgtcattgagctgggaatccctttcagtgatcccgttgcggaagggcctgtgatccaa
gaagcggataaccgtgctcttgccgcgggcttccgcattgatgcccttttcgatctgctt
gaaaaggtacgggaaaagacagagatcccccttgtatttttgacctatgccaatccgatc
tttacctacggacgtgaggctttctttacgcgctgtgccaaggccagcattgacggcgtc
attgtaccggacgtcccctttgaggaaagggcaactctgctgccgtttgcccgggaaaag
gggattgcgctcatttccctgattgcgccaacttctcatgagcgcgttcagatgcttgcc
cgtgaagcagaaggctatatctacctcgtttccagtatgggagttacaggtgttcgggag
aaaatcacgactgacctaaaggaaattgttgaaaagatccgggaagtatcaaaccagcct
gttgctgttggctttgggattgctcgccccgaacaggcggcgcaaatggcggacatcagt
gatggggccatcgtggggagcgccatcgtaaaacttgtggcaaagtacggcaaaacggcc
gtcggacctgttcgcgattatgtcctttccatggtggaagcggtcagggtgtga

DBGET integrated database retrieval system