KEGG   Acidaminococcus intestini: Acin_2186Help
Entry
Acin_2186         CDS       T01639                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ain  Acidaminococcus intestini
Pathway
ain00260  Glycine, serine and threonine metabolism
ain00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ain01100  Metabolic pathways
ain01110  Biosynthesis of secondary metabolites
ain01130  Biosynthesis of antibiotics
ain01230  Biosynthesis of amino acids
Module
ain_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ain00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acin_2186 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Acin_2186 (trpA)
Enzymes [BR:ain01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Acin_2186 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB BtpA Bacteriocin_IIi
Motif
Other DBs
NCBI-ProteinID: AEQ23382
UniProt: G4Q5T6
Position
complement(2209413..2210186)
Genome map
AA seq 257 aa AA seqDB search
MTRLTDAFKNKKAFIPFVTAGDPDLSTTEALIYAMEEAGASVIELGIPFSDPVAEGPVIQ
EADNRALAAGFRIDALFDLLEKVREKTEIPLVFLTYANPIFTYGREAFFTRCAKASIDGV
IVPDVPFEERATLLPFAREKGIALISLIAPTSHERVQMLAREAEGYIYLVSSMGVTGVRE
KITTDLKEIVEKIREVSNQPVAVGFGIARPEQAAQMADISDGAIVGSAIVKLVAKYGKTA
VGPVRDYVLSMVEAVRV
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgactagactaaccgatgcattcaagaataaaaaagccttcattccttttgtgaccgcc
ggtgacccggacctatccacgacggaagccctcatttatgccatggaagaagcaggggcc
agtgtcattgagctgggaatccctttcagtgatcccgttgcggaagggcctgtgatccaa
gaagcggataaccgtgctcttgccgcgggcttccgcattgatgcccttttcgatctgctt
gaaaaggtacgggaaaagacagagatcccccttgtatttttgacctatgccaatccgatc
tttacctacggacgtgaggctttctttacgcgctgtgccaaggccagcattgacggcgtc
attgtaccggacgtcccctttgaggaaagggcaactctgctgccgtttgcccgggaaaag
gggattgcgctcatttccctgattgcgccaacttctcatgagcgcgttcagatgcttgcc
cgtgaagcagaaggctatatctacctcgtttccagtatgggagttacaggtgttcgggag
aaaatcacgactgacctaaaggaaattgttgaaaagatccgggaagtatcaaaccagcct
gttgctgttggctttgggattgctcgccccgaacaggcggcgcaaatggcggacatcagt
gatggggccatcgtggggagcgccatcgtaaaacttgtggcaaagtacggcaaaacggcc
gtcggacctgttcgcgattatgtcctttccatggtggaagcggtcagggtgtga

DBGET integrated database retrieval system