KEGG   Acidaminococcus intestini: Acin_2187Help
Entry
Acin_2187         CDS       T01639                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ain  Acidaminococcus intestini
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ain00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Acin_2187 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acin_2187 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Acin_2187 (trpB)
Enzymes [BR:ain01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Acin_2187 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2210179..2211363)
Genome map
AA seq 394 aa AA seqDB search
MSNGRYGTHGGQYVPETLMNAVLELQKAYETYKKDPQFIKELQQLYHDYANRPSLLYYAE
RMTQDLGGAKIYLKREDLNHTGAHKINNALGQCLLAKKMGKKRIIAETGAGQHGVATATV
AALLGLECVVYMGKLDTERQALNVYRMKLLGADVVPVETGTKSLKDAVNEALREWSARCE
DTAYCIGSVMGPHPYPMMVRDFQKVIGEEVRQQMLEKEGRLPDVAMACVGGGSNAMGLFY
DFIPDPSVQLIGVEAAGRGIDTAETAATISCGRPGIFHGMESYFLQDDDGQIAPVYSISA
GLDYPGIGPEHAHLYDTGRAQYVAITDDEAVAAFEYLSRMEGVIPAIESAHAVAYAMKLA
PTLPKDKIIVICLSGRGDKDVAAIARYKGVDLHD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatggaagatatggaacccacggcgggcagtatgtaccggaaaccctgatgaat
gctgtcctggaactccagaaagcgtacgaaacctataagaaagatccccagttcatcaag
gaattgcagcagctctatcatgactacgccaatcggccgagtctcctttactatgcggaa
cggatgacccaggaccttggcggcgccaagatctatctcaaacgggaagacctgaaccat
acgggggcccacaagatcaataatgctttgggccagtgcctccttgcaaagaaaatgggc
aaaaagcgcatcattgcggaaacgggcgccggtcagcacggcgtggcaaccgctacggtc
gctgctttattgggccttgaatgtgtggtctacatgggaaagctggatacggagcgtcag
gccctcaacgtgtatcgcatgaaactgcttggtgctgatgtcgttcccgttgaaacaggg
acaaagagcctcaaggacgccgtcaacgaagccctgcgagagtggagtgctcgctgcgaa
gacacggcttactgcattggctctgtcatggggccccatccctatcccatgatggtccgc
gatttccaaaaagtcattggcgaggaagtgcgccagcagatgctggaaaaagaggggcgc
ctgcccgacgtggccatggcctgcgtaggcggcggcagcaatgccatggggcttttttat
gattttatccccgatccgtcggtccagctcatcggggtggaggcggctggacgcggcatc
gatacggctgaaacggcagcgaccatttcctgcggccggccaggtatcttccatggcatg
gaatcctatttcctgcaggatgatgacggccaaattgcaccggtttattccatctccgct
ggtcttgattatccgggcattggaccggaacacgcccatctttacgatacagggcgcgcc
cagtatgttgctattacagacgatgaagcggttgctgcctttgaatacctgtcccgcatg
gagggcgtcatcccagctattgaaagtgcccatgccgtggcctacgctatgaaattggca
ccgacccttcctaaggacaaaatcatcgtcatttgcttatcgggccgcggagataaggac
gttgcggccattgccagatataagggggttgatctccatgactag

DBGET integrated database retrieval system