KEGG   Acidaminococcus intestini: Acin_2217Help
Entry
Acin_2217         CDS       T01639                                 

Gene name
pfk
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ain  Acidaminococcus intestini
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ain00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acin_2217 (pfk)
   01230 Biosynthesis of amino acids
    Acin_2217 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acin_2217 (pfk)
   00030 Pentose phosphate pathway
    Acin_2217 (pfk)
   00051 Fructose and mannose metabolism
    Acin_2217 (pfk)
   00052 Galactose metabolism
    Acin_2217 (pfk)
  Energy metabolism
   00680 Methane metabolism
    Acin_2217 (pfk)
Enzymes [BR:ain01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Acin_2217 (pfk)
Protein phosphatases and associated proteins [BR:ain01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Acin_2217 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2238469..2239569)
Genome map
AA seq 366 aa AA seqDB search
MAEKRGTLAVLTGGGDCPGLNAVIRAVVKTAVTHGYEIYGIRNGFHGLIQDDMKKMSMAD
VSGILPRGGTVLGTTNRDNPFHYAAGEDAAGNVIYEDRRDDVVRNLNAHGIECLIVIGGD
GSLKIGYDLHRFCGVNVVGVPKTIDNDLPGTERTFGFDTAMAMATEALDRLHTTAESHHR
VMVLEVMGRYAGWIALHSGLAGGADVILIPEIPYRIESVIEKVKARQAQGKQFSIIVVAE
GSKPVGGKMTVARLVKNSFEQVRLGGVGNKLADEIEAKTGIEARCTILGYLQRGGSPTAF
DRVLSTRYGSAAVEACLAGAYNVMVALSSGEIVRIPIEEVAGKPHQVPLDSDLIRAGRNL
GISFGD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaaagaggaaccctggcagtccttacgggaggcggtgactgccctggcctc
aatgccgtcatccgtgccgtcgtgaagacggccgtgacccatggctatgagatctatggc
attcgcaacggcttccatgggcttatccaggatgatatgaaaaaaatgtccatggcggat
gtatcgggtatcctgccgcgcggcgggacggtacttggtacaacaaacagggataatccc
ttccattatgcggctggtgaagatgcagcaggcaatgtcatttatgaggatcggcgcgat
gatgtcgtaagaaaccttaacgcccatggcatcgagtgcctcattgtcattggcggcgat
ggaagcctcaagattggctatgacctgcaccgtttctgcggggtcaatgtcgtcggcgtt
cccaagaccattgataatgacctgccggggacggagcgaacctttggttttgacacagcg
atggcgatggctacagaggcattggaccgccttcataccacggcagaatcccatcaccgc
gtcatggtccttgaagtcatggggcgctatgcggggtggattgcccttcattccggcctt
gccggcggagcggatgtaatcttgatcccggaaatcccctaccggatcgagtctgtcatt
gagaaggtcaaggcccgtcaggctcaaggaaagcaatttagtatcattgttgttgccgaa
gggtccaaaccagtgggcggtaagatgacggtcgcccgtctcgtgaaaaatagctttgaa
caggtgcgcctgggcggcgtgggcaataaacttgccgacgaaatcgaggcgaagacgggt
atcgaagctcgctgtacaatcttgggctatctccagcgcggcggttcgccgactgccttt
gaccgtgtcctgtcgactcgttatggctcggctgccgtggaagcctgccttgccggggcc
tataatgtgatggttgccctgtccagtggggagattgtccgcatcccaatagaagaagta
gcgggaaaacctcatcaggtaccgcttgattcggatcttatcagggcagggaggaacctt
gggatttcctttggggattga

DBGET integrated database retrieval system