KEGG   Arachis ipaensis: 107606310Help
Entry
107606310         CDS       T04301                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV6 isoform X1
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
aip  Arachis ipaensis
Pathway
aip00052  Galactose metabolism
aip00500  Starch and sucrose metabolism
aip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aip00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    107606310
   00500 Starch and sucrose metabolism
    107606310
Enzymes [BR:aip01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     107606310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 107606310
NCBI-ProteinID: XP_016163839
Position
B07
AA seq 583 aa AA seqDB search
MEISATLVLVLLALFTFLQNVANGFDSWPHTNTINPFKYRVPENPPYRTSYHFQPPQNWM
NDPNGPMYYKGVYHLFYQHNPSAATFGDGIVWGHSVSYDLINWIHLNNAIEPSEAYDIIS
CWSGSATILLDGKPVIMYTGIDHNRHQVQNLAMPKNLSDPFLREWVKHTQNPVIIPSEVA
EVDNFRDPSTAWHGKDGKWRIIIGAQKGDQGRAILYQSEDFVNWKLEDANPFYATDNTGV
CECPDFYPVSINGTNGVDSSVESSSVRHVAKVGYLRMAHDYYFVGKYLSDEERFIADAKF
TGTSLDLRYDYGKFYASKSFFDYAKNRRILWGWVNESDSEKDDIDKGWAGVQSIPRQVWL
DNKSGNRLVQWPIEEVEKLRSKNISINGEKLGGGSILEVSGITASQADIEVLFEIPELEN
AESFDLSGVDPQLLCSNAPRSGIIGPFGLLALASKDLREHTAISFRVYKTSNKYVGLMCS
DQSRSSLQNGLDKTTYGTFFDVDSNPRTISLRSLIDHSIIESFGEGGRVCMSSRVYPKLA
TGNEAHLYVFNNGTMSILISKLNAWCMKEAEIGHVKNMSYKTC
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggagatatctgcaacactagtattagtgttacttgccttatttacttttctgcaaaac
gttgctaatggatttgattcatggccacacactaacactatcaatcctttcaagtacagg
gtacctgaaaacccgccttatcgaacttcttatcactttcagcctccacaaaattggatg
aacgatcctaatggaccaatgtattacaaaggagtttaccaccttttctaccaacataac
cctagtgcagcaacttttggtgatggaatagtatggggccattcagtgtcctatgatctc
atcaattggattcacctaaacaatgctattgaaccaagtgaggcatatgatatcattagt
tgttggtctggttcagccacaatcctcttagatggaaaacctgttatcatgtatactggt
attgatcataacaggcaccaagttcagaatttggctatgccaaagaacttatcagaccct
tttttaagggagtgggtgaaacacactcagaaccctgtgataattcctagtgaggttgct
gaagtggacaattttagagatccatcaactgcttggcatggaaaggatggtaaatggaga
ataatcattggtgctcaaaagggtgatcaagggagggcaattttgtaccaaagtgaggat
tttgttaattggaaattagaagatgctaatcctttttatgcaacagataatactggagta
tgtgaatgcccggatttttatccagtgtccatcaatgggactaatggggttgattcatct
gtcgaaagttcgagtgttaggcatgtcgcgaaggtaggctacctaagaatggcacatgac
tactattttgtgggaaaatatctctctgatgaagagaggtttattgctgatgctaaattt
acaggaactagtttggacttgaggtatgactatggtaaattctatgcttccaaatcattc
tttgactatgctaaaaacaggagaatattgtggggttgggtaaatgaatccgacagcgaa
aaagatgatattgacaaaggctgggctggtgtacagtcaattccaagacaagtttggctt
gataacaaaagtgggaaccgattagtacagtggccaatcgaagaagtcgaaaaactgcga
agcaagaacatcagtattaatggagagaaactcggaggtggatcaatacttgaagtatca
ggtatcactgcatcacaagctgatatagaggtattgtttgagattcctgaactagaaaat
gctgaatcctttgatctcagtggtgttgatcctcaactactctgtagtaatgcaccaagg
agtggcataatagggccatttggtttattagctttagcttcaaaagacttaagagagcat
actgcaatttcttttagagtatacaaaacatccaataaatatgtaggcctaatgtgcagt
gatcaaagcaggtcctcactgcagaatggccttgataaaacaacatatggaactttcttt
gatgtagattctaatcccagaacaatttcacttagaagcttgattgaccactctattatt
gagagttttggggaaggtggaagagtttgtatgagtagtagagtttatccaaagctagct
actggcaatgaggcacatctctatgtgtttaacaatggaacaatgagtatactgatctca
aaattgaatgcctggtgcatgaaggaagctgagattggacacgtgaaaaatatgagctat
aaaacttgttag

DBGET integrated database retrieval system