KEGG   Arachis ipaensis: 107629727Help
Entry
107629727         CDS       T04301                                 

Definition
(RefSeq) acid beta-fructofuranosidase 1, vacuolar
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
aip  Arachis ipaensis
Pathway
aip00052  Galactose metabolism
aip00500  Starch and sucrose metabolism
aip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aip00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    107629727
   00500 Starch and sucrose metabolism
    107629727
Enzymes [BR:aip01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     107629727
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357 Wzy_C_2
Motif
Other DBs
NCBI-GeneID: 107629727
NCBI-ProteinID: XP_020973904
Position
B03
AA seq 643 aa AA seqDB search
MGGIKDDVGHVPLLEAEEEEEGWRPLRLRGSYLGIFGSIVFLVSMAALIIYQGHDYYDEA
KIENKGNNNNNYNKVPRGVAEGVSAKSNSFLSETTPSYNWTNAMLSWQRTAFHFQPERNW
MNDPNGPLFHKGWYHLFYQYNPFSAVWGNITWGHAVSRDLIHWLYLPEAIVRDMWFDING
AWSGSATLLPGGEIVMLYTGYTDQQVQVQNLAYPADASDPLLLNWVKYAKNPVMVPPPGI
GPHDFRDPTTAWFGPDNKWTLTLGSMVNDSGLSLVYKTTDFINYELNDHFLHIVPGTGMW
ECVDFYPVSINGSVGLDTSANGPGVKHVLKASLDDTKLDYYAIGTYFIENDTWIPDDPDL
DVGIGLRLDYGKYYASKTFYDQNKQRRVLWGWINESDSEVADITKGWASLQTIPRTVLYD
KKTGTNLLQWPVEEIESLRLSSHELKELLVKPGTVVPLHIGPATQLDIFVEFEIELLESE
GIVNNVEGCGVGAVERSAFGPFGILAIANDELSELTPIYFRLSNYGNGTSTTTTTTTSTS
FCVDETRSSKAPDVSKLVFGSKVSVLSDEKLSLRVLVDHSIIESFAQGGRTVISSRVYPT
EAIYGAARLFLFNNATDINIKASLKIWQLNSAFIRPFPFHNTQ
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggggggtatcaaagatgatgtaggacatgttcctttgctagaagctgaagaagaagaa
gaaggatggaggcccttaaggttaaggggtagttaccttggcatatttggctctatcgtt
ttcctagtgtcaatggctgcactcatcatataccaaggccatgattattatgatgaagcc
aaaatagaaaacaagggtaacaacaacaataattacaacaaagtccctagaggagtagct
gagggcgtttcagcaaagtcaaactcttttctttccgagactactccttcttataattgg
accaatgctatgttatcttggcaaagaacagcttttcattttcaacccgaaaggaattgg
atgaacgatccaaacggtccattgtttcacaagggttggtaccatctattctaccaatac
aatcccttttcagcggtgtggggtaacatcacatggggccacgcagtatcaagggacctc
attcactggctctaccttccagaagccattgtcagagacatgtggttcgacatcaacggt
gcatggtcaggctcagcaacgctcttgccaggtggcgaaatcgtgatgctctacaccggc
tacaccgaccaacaagtgcaggttcaaaatctcgcataccccgccgacgcatctgatccc
ctcctcctcaattgggtcaaatacgccaaaaaccccgtcatggttcccccacccggcatc
ggcccacacgattttcgcgacccaacaacggcctggttcggcccagataacaagtggacg
ctcacgcttgggtcaatggtcaatgattctggcctttccttggtttataagacaactgat
tttattaactatgagcttaatgaccacttcctgcatatcgttccgggtacgggtatgtgg
gagtgtgttgacttttacccggtttcaataaacgggtcggttgggttggacacgtcagca
aatgggccaggtgtcaagcacgtgttaaaggcgagtttggatgatacaaagctggactat
tatgcaattgggacatattttattgagaatgacacgtggatacccgatgacccggatttg
gatgtgggtatcgggttgagattggattatggaaaatactatgcttcaaagacattttat
gaccaaaataaacaaagaagggtcctttggggttggattaatgaatcggatagtgaggtt
gctgatatcacaaagggttgggcatctcttcagactattccaagaacagtattgtatgac
aagaagactggaactaatttgcttcaatggccagtggaagaaatagagagtttgagactt
agcagtcatgaattgaaggaattattggttaaacctggcacagtagtgccattacatatt
ggccctgcaacacagttggacatatttgttgaatttgaaatagaattgctggaatcagaa
gggattgtgaataatgttgaagggtgtggagttggtgctgttgagagaagtgcttttgga
ccatttggtattttggctattgcaaatgacgaactttctgaactaacaccaatttatttt
cgtctttcaaattatggaaatggaacctcaactactacaactactactacttctacttcc
ttctgtgttgatgaaactaggtcatcaaaggcacctgatgtatcaaagctagtttttgga
agcaaagtgtctgttctaagtgatgaaaaactatcattaagagtattggtggatcattca
atcatcgagagttttgcacaaggagggagaactgtgatcagttctagagtttatccaaca
gaagcaatctatggagctgcaagattgttcctgttcaacaatgcaacagacattaacatc
aaggcctcccttaagatttggcaattgaactctgcttttatacgcccatttccctttcac
aacactcaatga

DBGET integrated database retrieval system