KEGG   Ajellomyces capsulatus: HCAG_00008Help
Entry
HCAG_00008        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K11874  
ubiquitin carboxyl-terminal hydrolase 16 [EC:3.1.2.15]
Organism
aje  Ajellomyces capsulatus
Brite
Enzymes [BR:aje01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     HCAG_00008
Peptidases [BR:aje01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   HCAG_00008
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 637 aa AA seqDB search
MPDKPATVAAYAAGASLAAITLFYVFGPNFTIDGEESNDSGRRKGIVGLLNPSNDCFINS
ILQALAGLGDLRLYLIRELHRRQLEGPEIHNVLPDAESVPRGETPEMVRDLQQAPVTRAL
KEMLDSLNERPIYRKTISARGFIVALETAFQTRISRNQQDAQEFLQIIAERLCDEYHAGL
KARERAVKRSLNGNADDSMLDVKSANGYSAGNSDSELDDGSPSADATVETLDAEFPFPFE
GKMESQIECQSCHYKYKPNQTSFVNLTLQVPQQSSATLSSCFDGLLKTEYIDDFRCDNCV
LLHAHQMKTAEMKKATSDREIKRLNRDISLIKEALEIDPETIPKGISMPNVENVPKRKIA
RHMRITSFPKIIAIHLSRSIYGQNNSTKNAAKVSFPERMPIGGILDQKWYKLLGIVCHKG
SHHSGHYESFRRNHLYAPFSTPDAFRSYSQSRSTSRNPSTAPSPKIIPKQKTPAGQDFDA
SPITLCDDTTSPLASSTSLSAPSAPLTSTNGGTSLPLSPASQQSTTLLHQEPPQQKNNDS
VSSFATPRLTLSPSSDADISSSSSLRHQSSTKATTKTVVPGAGLQSRIRRKKRANDRWWR
ISDDKVKECKTSDVLGMQREVYLLFYEMERPGDDEQD
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacaaaccggcaaccgttgcagcctatgctgctggcgcctccctagccgctatc
accctcttctacgtcttcggccccaatttcacgatcgacggcgaggaatcgaatgacagc
ggcaggagaaaagggattgttggcctgttgaacccgtccaatgactgctttatcaactct
atccttcaagccctggctggcctaggcgacctccgcttatacctgatccgagaactacat
cgacgccagctggaggggccggaaatacacaatgtcttaccggatgccgaaagcgttccg
cgtggagaaacgcctgagatggttcgcgacttgcagcaagcacccgttaccagagccttg
aaggagatgctcgacagcttgaatgagcggccgatatacaggaagacaatatcagcgcgt
gggtttattgtggctctggagacggcgtttcagacgcgaatcagtcggaatcagcaggat
gcccaggaatttttgcaaattattgcagaacggctctgtgacgaataccacgccggtctt
aaggcaagggaaagggcagtcaagcgctccctcaatggcaatgctgatgactcgatgttg
gatgtgaagtctgcaaatggatacagtgctggaaacagtgactcggaattagacgacgga
tcgccgtccgccgatgcgacagtggagactttagatgctgaatttcctttccctttcgaa
gggaagatggagtctcaaatagaatgtcaatcgtgtcactataagtacaaaccaaaccag
acatcattcgtcaaccttacactgcaagtgccccagcaaagctctgctacgttaagttcg
tgcttcgacggcctgcttaaaacggaatatatagatgatttccgttgtgacaactgcgtg
cttcttcacgcacatcagatgaagacagcagaaatgaagaaggctacctcggaccgggaa
atcaagcggctaaaccgcgacatatcactcataaaagaagcgcttgagattgacccagaa
accattcccaagggcatcagtatgccaaatgttgaaaacgtcccgaaacgcaagattgcc
cgacacatgcgaatcacatccttccccaaaataatcgccatacacctgtcccgttcgatc
tacggccagaacaactctacaaagaatgccgccaaggtgtcgtttcccgaacgaatgccc
atcggcggcatcctcgaccagaaatggtacaagctgctggggatagtctgtcacaagggc
agccatcatagcggccattacgaatcctttcggcgcaaccatctctacgcccccttctcc
accccagacgctttccgctcttactcgcaaagtcgctcaacaagcagaaacccatccact
gccccgagtcccaaaattatccccaaacaaaagactcctgctggccaggatttcgatgct
agccctattaccctatgtgatgacaccacatctccattagcgtccagtacttccctctct
gccccttccgccccccttaccagtacaaacggaggaacgtccctccccctctctccggcc
tcgcaacaatcaactacactcctacatcaagaaccacctcaacaaaagaacaatgactcc
gtctcatcatttgctacgccgcgactcaccctatctccatcatcagatgctgatatatcg
tcctcctctagtctaaggcaccagtcgagcacgaaggcaacaacgaaaacggtggtgccg
ggtgctggactccagtcccgcatccggcggaagaaaagggcgaatgaccgctggtggcgg
atcagcgatgataaagttaaagaatgcaaaactagcgatgtgttggggatgcagagagag
gtgtatttgcttttctacgaaatggaaaggccgggtgatgatgagcaagattaa

DBGET integrated database retrieval system