KEGG   Ajellomyces capsulatus: HCAG_00181Help
Entry
HCAG_00181        CDS       T02229                                 

Definition
similar to MAP kinase kinase
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
aje  Ajellomyces capsulatus
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:aje04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 343 aa AA seqDB search
MSSPAPLLKIPTPGANRKQAPRLKLGIPGSPKLNIANSNGAGTNPAPDVPQLSQPIPARP
APPQLRLATPKGSKGTPQEVSSLNNGRPSMHIVTGASATSYNGDYGNRSRSGSFNTYDGR
VSGPTSATSSNYSALSFAIGLRQPPGGTPDPTSAISSVYSDRGDGGLSVERDNSMNGLLP
DLEKLSLEKGRPLDVEDLDDEGWLAASSQKKIIELDSLGEGAGGAVTRCMLKGGKTVFAL
KIITTDPNPDVKKQIVRELNFNKDCASEHICRYYGAFMDKSTSTISIVMEFCEGGSLDSV
YREVKKLGGRTGEKVLGKVAEGVLNGLTYLHGRKIIHRDIKPF
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctcccgccccgctcttaaaaatacctactcctggtgccaaccgcaaacaagca
ccccgtcttaaattggggatcccaggctcgcccaagttgaacattgccaattcaaatggg
gctggaaccaaccctgctccggatgttcctcagctttctcaaccaatccctgctcgtcca
gctcctccccagcttagattagccacaccgaagggaagtaaaggaactccacaagaagta
agttctttgaacaatggacgaccatctatgcacatagtgacaggcgcttctgcgacatct
tataatggcgactatggcaaccgctcaaggtcaggaagcttcaacacatatgatggccga
gtcagtgggcccacatcagctacctcttcgaactattccgccttatcttttgccattggc
ttgagacaacctcccggaggaacgcctgatcccacttctgccattagttctgtatactct
gaccggggagatggcggcttatcagtggaaagagataacagcatgaacggcttgttacca
gatctggagaagctgagtttggaaaaagggcggccgttggatgtggaggacctagatgat
gaaggctggctggctgccagctctcaaaagaaaattattgagcttgacagccttggtgag
ggagccggtggtgccgtcactcgttgtatgcttaaaggtggaaaaacggtgtttgctcta
aagattatcaccacagacccgaacccagacgttaagaagcagattgttcgggaattgaat
ttcaataaagactgtgcatcggaacatatttgccggtattacggtgcttttatggacaaa
tcaaccagcaccatatcgattgttatggaattttgcgaagggggcagtctggacagcgtt
tatagagaagtgaagaagcttggaggacggacgggagagaaagttttgggtaaggtagct
gagggcgtactaaacggccttacctaccttcacgggcgtaaaattatccatcgagatatc
aagcctttctaa

DBGET integrated database retrieval system