KEGG   Ajellomyces capsulatus: HCAG_00450Help
Entry
HCAG_00450        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
aje  Ajellomyces capsulatus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 455 aa AA seqDB search
MTGGTICMQRSDSGFIPARGFQKTALEPVPIFNDKSNPKPLDVVINGIGERRLHDSLRTL
PTSYGGRVRYTVFEFDELLDSSSIDSKGWAQIALTISWNYTLFDAFVVLHGTDSLAYTCS
ALSFMLRNLGKPVILTGSQAPMLELQNDATNNLLGSLVIAGNFMIPEVCLYFNYKLLRGN
RATKVSASAFAAFDSPNFAPLAVTTAMKTNVAWDLVHRPTHIEHFSIQVNLDTTHVACLR
IFPGIKPEMVDAVLRLEGLKGLVLETFGAGNAPGGQDNAMTDVLAAAIKRGIVIVNVTQC
LSGFVSPVYAPGMTLYRAGVVAGQDMTTEAALTKLAYLLALPGATPQSVARDMSISLHGE
LTEHSQPLFEHPDGALPQRVKSLAALGYAIAHGDLEKVKDILRGEEEWILNDADYSGNTP
LFPSIPFPECVIFTGSGRGKQEEEEVVIGTPPRAC
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcggcacgatatgcatgcagcgctctgattccggcttcatccccgcacgcggc
tttcagaagactgcgctggagcctgtccccatcttcaatgacaaatccaaccccaaaccc
ctcgacgtcgtcattaacggcataggtgagcggcgactacacgatagcctccgcacacta
ccaacctcctatggcggccgcgtccgctacacagtcttcgaattcgatgaactgctcgac
agcagctcaatcgactcgaagggctgggcccaaatcgccctcactatctcctggaactac
acgctcttcgatgccttcgttgtcctgcatggtacggacagtctggcctacacatgctcc
gcactcagcttcatgctgcgcaacctagggaaaccagtgatattgaccgggtcgcaggcc
cccatgcttgagttgcagaacgacgctacgaacaatctcctcggctcgctggtgatcgcg
ggcaatttcatgattccggaagtatgtttgtattttaactataagctgctgcgggggaac
cgggcaactaaagtgtccgcgagcgcatttgcagcgttcgattcgccaaatttcgcgccc
ctggctgtcacaacggccatgaagacgaatgtggcgtgggatcttgtacataggccgacg
catattgagcattttagcatccaggtcaacctggatacaacgcatgtggcctgtctgagg
atattccctggaattaagccagagatggtggacgccgtgttgcggttggagggattaaag
ggccttgtgctcgagacgtttggcgccggaaatgcaccaggtggtcaggataatgcaatg
acggacgtgctcgcggctgcgattaagcgcgggattgttattgtaaatgtcacgcaatgc
ctttccggttttgtcagcccagtttatgctccaggaatgaccctctaccgtgccggcgtt
gttgctggtcaagatatgacgacggaagctgcattgactaaacttgcctacctacttgct
cttcccggggcaacccctcaatctgtcgcgcgcgacatgtccatctcccttcatggagaa
cttactgaacactcacagccacttttcgaacacccagacggcgctttaccacaacgagtc
aagagtttggctgcactgggctacgcgattgcgcatggagacctcgagaaagtgaaggat
atcctccgtggtgaggaggagtggattttgaatgatgctgattattcagggaatactcca
ttgtttccatccattcctttccccgagtgtgtgatttttactgggagcggacgtggaaag
caggaagaggaagaagtagtaatagggacgcccccgcgcgcctgttaa

DBGET integrated database retrieval system