KEGG   Ajellomyces capsulatus: HCAG_00516Help
Entry
HCAG_00516        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
aje  Ajellomyces capsulatus
Brite
Enzymes [BR:aje01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     HCAG_00516
Peptidases [BR:aje01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   HCAG_00516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1116 aa AA seqDB search
MDAMARSFGFQCKAVTLTPPSRFLLVIFMVNVAPKLDTPRQINIGGRAASLRNTGSYRSQ
LTDNDMVVDDYDQYGNDRSDVVVVSPPGSSSEPEPEPLATDFEAMMAKVLPENPDLETEA
QTYHTWNIENWTKLRRKEHGPVFECGGAPWRVLFFPFGNGVEHASFYLEHGFEKSPPDVA
HHRFNADEADWGFTRFCELRKLFQQSINDKGTPLVENEAANVTAYVRVVKDPTGVLWHSF
QKSLRFEERNWNVSIFYKLVPKEHDANRSNSAWTLQRLFYHLQTSDLPVSTAELTSSFGW
ESRHTFEQQDVQELSRLLMDKLEGQMKGTPAEKALPSLFVGKTKTYISCIHVDYESSRIE
DFWDIQLNVRGNRTLDDSFKDYIQVETLEGENKYDAGEPYKLQDAKKGVIFESFPPVLHL
HLKRFEYDINRDAMMKINDRLEFPEEFDAAPYLSEDADKSEPWIYQLHGVLVHSGDFNAG
HYYAYLRPTKDSLFYRFDDDKVIRATMKETLEENFGGEYPNLANGTAGVRQPYMRGFSTK
RSMNAYMLVYIRKSRVDDVLVSLKKDDIPAHLEKRLNEERAELARKKKEREEQHLYMNVG
LLTDESFKSHHGFDLTSLDLEPDDPAAAKIHRVLRAKKVGEFAAEIAEEKGLTPDQVRLW
VMVNRQNKTTRPDQPLKDLEMSVEEAFTRFGTKGNQFRLFVEVGEIGTDGKVTWPETSGN
NATSLVFLKHFDVLQQTLTGVGHAFVRKHSKVSELAGPILEIMNWPAGTPFILYESEIQD
GDIICFQRQVNDSELPPTVLYTDARQYYDYLLNRISVKFAPLKPNDSETFDLTLSRKMTY
EQWTTKVGEHLNVDPTHIRFAPVLQNSGKPKPFIKRNATQNLQQILTSQYSAYGYAAHRP
DALYYEILETSLSEYETKKIIKVIWLPDGISKEQPFDVLVSKSGNIGDLLLSFRKRANLD
EETSKNLRCYEVYGGKVYKEIPENYSILSLSDYVTLYIERIPQEELDMQEGEFKIDCFNF
DKEPNKPHGVPFRFVVKPGEIFKETKERLSKRTGIRGKQFEKIKFAMALRQGFCTPRYIE
DDDVLADLATEPQDVLGLDHVNKNRSFWRSESFFIR
NT seq 3351 nt NT seq  +upstreamnt  +downstreamnt
atggatgccatggcccgatcatttggttttcagtgcaaagcagtcactctaactcctcca
tcaaggtttctattggtgatatttatggtaaatgttgcaccgaagttggatacacccaga
caaattaatattggcggtagagccgcttcgctgagaaatactggtagttaccgttcacag
cttacggataatgatatggttgtcgatgactacgaccagtacggcaatgaccgttctgat
gtcgtcgtcgtctctccacctggctcctccagtgagcccgaaccggagcctctggctacc
gactttgaggcgatgatggcaaaagtgcttcccgagaatccggatttggaaacagaagcg
cagacgtatcatacatggaacatcgagaactggacaaaattgcggcggaaggagcacggt
ccggtttttgaatgtggaggagctccatggcgcgtcctgtttttcccattcgggaacggt
gtcgaacatgcgtctttctacctcgaacacggcttcgagaagtcacccccggatgtcgca
caccaccgctttaatgcggatgaggccgactggggttttacacggttttgcgaactgcgg
aaattattccagcaatccatcaatgataaaggtactcctttggtagagaatgaagccgcc
aacgttaccgcatatgtccgcgttgtgaaggatccaacaggagttttatggcatagtttc
caaaagtctttacgattcgaagaaagaaactggaatgtctctattttttacaaactcgtt
ccgaaagaacacgacgccaataggtcaaattccgcgtggacccttcagcgactattttac
catctgcaaactagcgatcttccagtgtcgacagctgaactcacctcctcctttggctgg
gaatcgaggcatacttttgaacaacaggatgtccaagaactttctaggttattaatggat
aaactcgaaggacagatgaaaggcactcctgccgaaaaagcgcttccctctcttttcgtt
ggaaagacaaagacatatatatcctgcattcacgttgactacgagtcgtccaggatagaa
gacttttgggatatccaactgaacgttcgagggaatcggacgctggatgacagcttcaaa
gattacatccaggtggaaaccttagagggagagaacaagtatgatgctggggaaccatac
aaactacaggatgcgaaaaagggcgtgatatttgagagtttccctcccgttcttcacctt
catctcaaacgattcgaatatgacatcaaccgagatgctatgatgaaaatcaacgacaga
ctcgagtttccagaagagtttgacgcggcaccgtatctttccgaggatgcagataaatca
gaaccttggatctatcaattacacggcgttcttgtgcatagcggtgacttcaatgctggg
cactattatgcatatctgcgaccaactaaggacagtttattttatagatttgacgacgac
aaggttattcgcgcaaccatgaaggaaactctcgaggaaaattttggtggggaatatccc
aacctcgcaaacggaacagctggggttagacaaccatacatgcgaggcttctccacgaaa
cgatcaatgaacgcatacatgctggtttatatcaggaaatctcgcgtggatgatgtactt
gttagtttgaagaaagatgacattcctgcacatctcgaaaagcgtctcaatgaggaacgt
gctgagttagcgcggaagaaaaaggagcgggaggaacaacatctttatatgaacgttgga
ttgttaaccgatgagtcattcaagtctcatcacggatttgatttgaccagcttagatttg
gaacctgacgatcccgcagctgcgaaaatacaccgcgtccttagggctaagaaagttggc
gagtttgcggccgagatcgcggaagaaaagggattgacaccagatcaagtgaggctatgg
gtaatggtgaatcgtcaaaataaaacaacacgtcctgatcagcccctgaaagatctcgaa
atgtctgttgaggaggcgttcactcggtttggtaccaagggaaatcagttccggctattt
gtcgaggtaggagaaataggtacggatgggaaagtaacctggccagaaacctcaggcaat
aacgcgacgagcctcgttttcctgaaacactttgatgttctccagcaaacgctcactgga
gtaggtcatgctttcgttcgaaagcactctaaagtatcagaactggccgggccaatactg
gagattatgaattggcctgcaggaaccccattcatattatatgagtcggaaatacaagat
ggggatatcatctgcttccaacgccaagtcaacgattctgaactccctcctactgtccta
tacacagatgcgaggcaatactacgattacctcctcaaccgtatctcagtcaaatttgct
cccctaaagccaaatgatagcgaaactttcgatctgacactcagccgcaagatgacatac
gagcaatggacaacgaaagttggggaacatttgaatgtcgatccgactcatatacgattt
gcacctgtactccagaatagtggaaaacctaagccgttcatcaaacggaatgcgacccaa
aatctccagcagattctcaccagccagtattccgcttacgggtatgctgcgcatcgacca
gacgccctttattacgaaattttggaaaccagtttaagcgaatatgaaacgaagaagata
ataaaggtcatttggcttccggatggcatttccaaagagcaaccatttgacgttcttgtc
tctaagagcggcaatattggtgatctactattaagcttccggaagagggctaacctcgat
gaagagacgtccaaaaatctgcgttgttatgaggtctatggcggaaaagtttacaaagag
atccccgaaaactatagcattctcagcctctcggactatgttactctctatatcgagcgg
ataccacaggaggaacttgacatgcaagaaggtgaattcaaaattgattgcttcaatttt
gataaggagcccaataagccacatggagtcccttttagatttgttgtgaaaccgggcgag
atcttcaaggagaccaaggaacggctctcgaaacggacaggaattcgaggcaagcagttt
gagaaaatcaaatttgccatggctttacgtcaagggttctgtaccccaagatacattgaa
gatgacgacgttctcgccgatttagcgaccgagccacaagatgtgctcggactggatcat
gtaaataagaacagaagcttctggagaagcgaaagtttctttattcgatag

DBGET integrated database retrieval system