KEGG   Ajellomyces capsulatus: HCAG_00523Help
Entry
HCAG_00523        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
aje  Ajellomyces capsulatus
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:aje00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    HCAG_00523
Translation factors [BR:aje03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    HCAG_00523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 350 aa AA seqDB search
MDNANLWTRRSNKLSLSMSGSDAKETSGRQDSSRSHTSKRFGPDSSHGRSNPFNVILPLT
TNAPSPSAGASSAFGLGSGAFASFGSAKTPKTPGAFDLSAPKSSEKRETQPEDEGVNNKT
VKSKASSSSLNNTPTTPALKEHPIRSTWIVWYRPPTPKHSDYEKSTIALASISSVESFWA
VYSHLKRPSQLPSVSDYHIFKKGIRPVWEDEANKRGGKWIVRLKKGVADRYWEDLLLAMV
GDQFAEASDEVCGAVLSVRSGEDVLSVWTRIDGGRNIKIRETIKRLLAFPPDTNIAWKSH
DDSIAQRSAIDQARQDKAAANASHHNQGSDRRRGQNQDDTSADKGRTAAS
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggacaatgccaacctgtggactcgccggtcgaacaagctctccctttccatgtccggt
tcggacgccaaagagaccagtggaagacaagattcctctcgaagtcatacatccaagcga
tttggtcctgacagttctcacggacgatcgaaccctttcaacgtgatcttacccctcact
acgaacgcaccatctccctccgccggcgcctcgtccgcttttggcttaggatctggtgcg
tttgcctccttcggctcggccaaaacaccaaaaacccctggcgcatttgatcttagcgcc
ccaaaatcgagtgaaaaacgagaaacgcagccagaagacgaaggggtgaataataaaacc
gtgaagtcaaaggcgtcatcttcttctctcaataataccccaacaactcctgctcttaaa
gaacaccccataaggtctacttggatcgtttggtaccgacccccaacaccaaaacattct
gactacgagaaatctaccatagctcttgcatcgatatcttctgttgagagtttttgggcc
gtttactcacaccttaagcggccttctcagctcccgtcggtgtcggactaccatattttt
aagaaaggaatacgaccagtttgggaagatgaagcaaacaaacgtggagggaaatggatc
gtcagattgaagaagggggttgctgatcgctattgggaagatttgcttctggcaatggtg
ggcgatcaatttgcggaagcaagcgatgaggtgtgcggggcggttctgagcgttagaagt
ggggaggacgtcctgtctgtctggacgaggattgatggtgggcggaatatcaaaattcgg
gaaactataaaacgcctgttagccttccctccagacaccaacattgcctggaaaagtcat
gacgatagcattgcgcaacgttccgccatcgaccaggcccgccaggataaagccgctgca
aatgcaagtcaccataatcagggctcagatcgtcgacgtgggcaaaaccaagatgacact
tcggctgataaagggcggactgcagcatcgtaa

DBGET integrated database retrieval system