KEGG   Histoplasma capsulatum: HCAG_00714Help
Entry
HCAG_00714        CDS       T02229                                 

Definition
(RefSeq) serine/threonine-protein kinase PRKX
Organism
aje  Histoplasma capsulatum
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 412 aa AA seqDB search
MAAEILHELQLQHTTPQNALQNQDIDIDVTTTEKPLQQNNSLDHPKKRFALERCNPGPPA
SRPRTPQDIVENRAEGKLDTSSSELSIGDFELLQTLGTGTFARVWLVRLLKHTGKFKNGA
YALKVLHKADVIKLKQVEHVRNEIETLNAVAGHPFITTLVATFTDDLSLYMLLEYCPGGE
IFTFLRRARRFDVSTAQFYAAEIVLILEFLHDVHGIAYRDLKPENILLDADGHLKLVDFG
FAKEIWSRETYTLCGTPEYLAPEVIHNSGHGLAVDWWALGVLIYEFIVGQPPFWDPNPMR
IYKQIVDGVLRFPANMPPAAQDIVSRLCQTNPSERLGHIKGGSARVKQHSFFKGVNWDDI
YHRRMKGPIVPRVDSPTDAGNFEIYPDPPHPSELAPYTKDMRDAYEHMFKTF
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggaaattcttcatgagctgcagctgcagcacaccaccccgcaaaatgcgctc
cagaatcaagacatcgatatcgacgtaacaacgactgaaaaacccctacaacaaaacaac
agtctcgaccatccgaagaagagattcgcactagaacgttgtaaccccggtcctccagcc
tcgcgcccgcgaaccccgcaggatatcgttgagaaccgggcggagggtaagcttgacaca
tcatctagcgaactgagcattggtgacttcgagctgctacaaacactgggtacaggcaca
tttgctcgagtatggctggttcgcctcttgaagcacacaggtaaatttaagaacggagca
tatgcgcttaaggttcttcataaggcggatgttataaaactgaaacaggttgagcatgtc
cggaatgaaatcgaaaccctaaatgctgttgctgggcaccctttcatcactaccctggtc
gccacatttacagacgatctgagcttatatatgttgctcgaatattgcccaggaggagag
attttcacattcttgagacgcgcgcggaggtttgacgtgtcgactgcccaattttatgct
gcggaaatcgtcttaattcttgaatttctccacgacgtccatggcatcgcgtaccgcgac
ctcaagcccgaaaacatcctccttgacgcagatggccacctgaaactcgttgatttcgga
tttgcgaaagagatttggagcagggaaacctacacactctgcggtacgccagagtaccta
gcaccagaagtcatccataactccggccacggcctagctgttgattggtgggctctgggc
gtcctgatatacgagttcatagtcggacaacctccattctgggacccaaatcccatgcgc
atatacaaacagattgttgatggggtcctacgatttcctgccaacatgcccccagccgcg
caggatattgtatctcggctgtgccaaacgaacccatccgagcgcctgggtcacattaag
gggggatccgccagagtgaagcaacattccttcttcaagggagtcaattgggatgatatt
taccaccgacgaatgaagggacccatagtcccccgtgtggattccccgaccgatgcaggg
aatttcgaaatttacccggaccctccacacccgtcggagcttgctccgtacacgaaggat
atgagagacgcgtatgagcatatgttcaagactttctaa

DBGET integrated database retrieval system