KEGG   Ajellomyces capsulatus: HCAG_00760Help
Entry
HCAG_00760        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
aje  Ajellomyces capsulatus
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:aje00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:aje04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 243 aa AA seqDB search
MNWQTYDVGMQLNQAMFASGTDQTGYVLKPDSLRTSPSPRKLVTFTVDIISAQQLPRLQG
MGPDDSINPYVEIELFCADDKRKGLAFGEGGVDTSARNGMSGIGQPHRRRTRIEQQNGYN
PVFNDQFKLSLETKYPDLVFVRWVVRNSPDGRSFGGNNSVQLATFTAKLSSLSQGYRYLP
LYDASGDQYLFSTLFCKITKSDPVPAQRAGFEGWRGDQKGIIRQLRHTLSKRTSPTEGQG
EGL
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaactggcaaacctacgacgtcggtatgcagctgaaccaagcaatgtttgcttctggc
accgaccagactggctatgttctaaagccggatagcctacgaacatctccctcgcctaga
aaattagttacgttcaccgtggatatcatctctgcacagcaactcccaagactacaagga
atgggccccgatgatagtattaacccgtacgttgaaattgagctgttttgcgccgatgac
aaacggaaaggtctcgcattcggcgaaggcggtgttgatacttctgctcgcaacggcatg
tctggaatcggtcaaccccaccgtcgtcggacaaggatcgagcaacagaatggttacaac
ccggtgtttaacgaccaattcaagctgtcactggagacgaagtaccccgacctggtcttc
gtccgttgggtcgtccgtaactctcctgatggacgaagtttcggcggtaacaacagcgtg
caacttgccacttttaccgcaaaactcagtagcctctcccaaggatacaggtatctacct
ctctacgatgcaagtggtgatcaatatctgttctcaacgcttttctgcaaaatcactaaa
tctgatcccgttcctgctcaacgggccggtttcgaaggctggagaggagatcagaaaggt
attatcaggcaacttagacacaccttgtcaaaacgcacatcaccaacagaaggacaggga
gaaggactgtga

DBGET integrated database retrieval system