KEGG   Ajellomyces capsulatus: HCAG_00760Help
Entry
HCAG_00760        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
aje  Ajellomyces capsulatus
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    HCAG_00760
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    HCAG_00760
Enzymes [BR:aje01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     HCAG_00760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 243 aa AA seqDB search
MNWQTYDVGMQLNQAMFASGTDQTGYVLKPDSLRTSPSPRKLVTFTVDIISAQQLPRLQG
MGPDDSINPYVEIELFCADDKRKGLAFGEGGVDTSARNGMSGIGQPHRRRTRIEQQNGYN
PVFNDQFKLSLETKYPDLVFVRWVVRNSPDGRSFGGNNSVQLATFTAKLSSLSQGYRYLP
LYDASGDQYLFSTLFCKITKSDPVPAQRAGFEGWRGDQKGIIRQLRHTLSKRTSPTEGQG
EGL
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaactggcaaacctacgacgtcggtatgcagctgaaccaagcaatgtttgcttctggc
accgaccagactggctatgttctaaagccggatagcctacgaacatctccctcgcctaga
aaattagttacgttcaccgtggatatcatctctgcacagcaactcccaagactacaagga
atgggccccgatgatagtattaacccgtacgttgaaattgagctgttttgcgccgatgac
aaacggaaaggtctcgcattcggcgaaggcggtgttgatacttctgctcgcaacggcatg
tctggaatcggtcaaccccaccgtcgtcggacaaggatcgagcaacagaatggttacaac
ccggtgtttaacgaccaattcaagctgtcactggagacgaagtaccccgacctggtcttc
gtccgttgggtcgtccgtaactctcctgatggacgaagtttcggcggtaacaacagcgtg
caacttgccacttttaccgcaaaactcagtagcctctcccaaggatacaggtatctacct
ctctacgatgcaagtggtgatcaatatctgttctcaacgcttttctgcaaaatcactaaa
tctgatcccgttcctgctcaacgggccggtttcgaaggctggagaggagatcagaaaggt
attatcaggcaacttagacacaccttgtcaaaacgcacatcaccaacagaaggacaggga
gaaggactgtga

DBGET integrated database retrieval system