KEGG   Ajellomyces capsulatus: HCAG_00793Help
Entry
HCAG_00793        CDS       T02229                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
aje  Ajellomyces capsulatus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aje01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:aje00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:aje00750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 536 aa AA seqDB search
MSGTDSQRYLSTRGSSCGLSFEDVVLKGLASDGGLFIPEAIPQLPEGWESKWRDFTFQEL
AFEIMSLYISPSEIPPADLKNIINRSYSTFRSTDVTPLVTLDDSKQLYLLELFCGPTFAF
KDVALQFLGNLFEYFLARRNQGKSGKDRLHLVVIGATSGDTGSAAIYGLRGKEDTSIFIL
HPKGKVSAIQEAQMTTVLDPNVHNLSVQGSFDDCQAMVKSMFADPEMNLKYKLASVNSIN
WARILAQMTYYIHSYFSLTRSPKYTKDKSIRFVVPSGNFGDILAGWFAKQMGLLTEKLVI
ATNENDILDRFWKTGQYTKKPTGNGATGAEPSGVKETFSPAMDILVSSNFERLLWFLAIK
VFGGDGDIHLQRQRASDIVRRWLGDLQTQGGFRVEPAVLDAAKEHFESERVSDLETIDTI
RDIYSSCFPASPVSSGTRGSTGGYILDPHSAVGVAASLRSIDRNPGTHHISLSTAHPAKF
VSAVDMALGGQDGYEFDNIVPPEFAGLLRKERRVIEVPAGEGWKAVSKIIDANVKL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggacggattcgcagaggtatctgagtactcggggctcatcatgcggactatct
ttcgaagatgtcgtgctgaaaggtcttgcgtcagatggcggcttgttcattccagaagcc
atcccccaactaccggagggctgggagtcaaagtggcgggatttcacattccaggagttg
gcatttgagattatgtctctgtatatctccccttcagagatccctccagcggatctaaaa
aatatcatcaaccgtagctattcgactttccgatcgacagatgttacgcccctcgttacc
ctcgatgactcaaagcaactctaccttcttgaactgttctgcggcccgacgtttgcattc
aaggatgttgctctgcagttcctcggaaacctctttgagtattttcttgcacggcgaaat
caagggaagagtggaaaagaccgactgcacctcgttgtgatcggagctacgagtggagac
accggttccgctgctatatatggcctgagagggaaggaagatacttcgatattcattctg
catcctaagggaaaagtctctgctatccaagaggcccaaatgacgaccgtcctcgatccc
aatgtccataaccttagcgttcaaggctccttcgatgactgccaagctatggtcaaatcg
atgtttgctgatccagagatgaacctcaagtacaagttggcgagtgtgaactcgataaat
tgggcgcgcatccttgcccaaatgacttactacattcactcttatttctccctcaccaga
agtccaaaatacaccaaagacaagtccataaggtttgtcgtaccatcaggtaatttcggt
gatatccttgctggctggtttgcaaaacaaatgggccttctcacagagaagctagtcatc
gcaacaaacgaaaacgacattcttgaccgattctggaaaaccggccaatataccaagaaa
cctaccgggaatggggccacaggcgcggagccgagtggcgtcaaagaaaccttcagccca
gccatggatatcctagtctcaagcaatttcgagcgcctcctctggtttctcgccattaaa
gtctttggcggagacggagatattcatctacagcggcaaagagccagcgatatcgtccgc
agatggcttggcgatctgcaaactcaaggcggcttcagagttgagccagccgttcttgat
gctgccaaagaacatttcgaatctgagcgtgtctccgatttggaaaccatcgacactatt
cgcgacatctactcctcttgtttccccgcctccccagttagtagcggaacaagaggcagc
acgggtggatacatccttgatccacactccgctgttggagttgctgcttcccttcgatct
attgatcgcaaccctggcacacatcatatttctctgtcaacggcacacccagcaaaattc
gtttcagctgttgatatggcgctaggaggccaggatggctacgagtttgacaacattgtt
ccaccggagtttgcggggttgttgaggaaagagcgccgtgtgattgaggttcctgcggga
gaagggtggaaggccgtgagcaaaattatcgacgcaaatgttaagttgtag

DBGET integrated database retrieval system