KEGG   Ajellomyces capsulatus: HCAG_00793Help
Entry
HCAG_00793        CDS       T02229                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
aje  Ajellomyces capsulatus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HCAG_00793
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HCAG_00793
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HCAG_00793
Enzymes [BR:aje01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HCAG_00793
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 536 aa AA seqDB search
MSGTDSQRYLSTRGSSCGLSFEDVVLKGLASDGGLFIPEAIPQLPEGWESKWRDFTFQEL
AFEIMSLYISPSEIPPADLKNIINRSYSTFRSTDVTPLVTLDDSKQLYLLELFCGPTFAF
KDVALQFLGNLFEYFLARRNQGKSGKDRLHLVVIGATSGDTGSAAIYGLRGKEDTSIFIL
HPKGKVSAIQEAQMTTVLDPNVHNLSVQGSFDDCQAMVKSMFADPEMNLKYKLASVNSIN
WARILAQMTYYIHSYFSLTRSPKYTKDKSIRFVVPSGNFGDILAGWFAKQMGLLTEKLVI
ATNENDILDRFWKTGQYTKKPTGNGATGAEPSGVKETFSPAMDILVSSNFERLLWFLAIK
VFGGDGDIHLQRQRASDIVRRWLGDLQTQGGFRVEPAVLDAAKEHFESERVSDLETIDTI
RDIYSSCFPASPVSSGTRGSTGGYILDPHSAVGVAASLRSIDRNPGTHHISLSTAHPAKF
VSAVDMALGGQDGYEFDNIVPPEFAGLLRKERRVIEVPAGEGWKAVSKIIDANVKL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggacggattcgcagaggtatctgagtactcggggctcatcatgcggactatct
ttcgaagatgtcgtgctgaaaggtcttgcgtcagatggcggcttgttcattccagaagcc
atcccccaactaccggagggctgggagtcaaagtggcgggatttcacattccaggagttg
gcatttgagattatgtctctgtatatctccccttcagagatccctccagcggatctaaaa
aatatcatcaaccgtagctattcgactttccgatcgacagatgttacgcccctcgttacc
ctcgatgactcaaagcaactctaccttcttgaactgttctgcggcccgacgtttgcattc
aaggatgttgctctgcagttcctcggaaacctctttgagtattttcttgcacggcgaaat
caagggaagagtggaaaagaccgactgcacctcgttgtgatcggagctacgagtggagac
accggttccgctgctatatatggcctgagagggaaggaagatacttcgatattcattctg
catcctaagggaaaagtctctgctatccaagaggcccaaatgacgaccgtcctcgatccc
aatgtccataaccttagcgttcaaggctccttcgatgactgccaagctatggtcaaatcg
atgtttgctgatccagagatgaacctcaagtacaagttggcgagtgtgaactcgataaat
tgggcgcgcatccttgcccaaatgacttactacattcactcttatttctccctcaccaga
agtccaaaatacaccaaagacaagtccataaggtttgtcgtaccatcaggtaatttcggt
gatatccttgctggctggtttgcaaaacaaatgggccttctcacagagaagctagtcatc
gcaacaaacgaaaacgacattcttgaccgattctggaaaaccggccaatataccaagaaa
cctaccgggaatggggccacaggcgcggagccgagtggcgtcaaagaaaccttcagccca
gccatggatatcctagtctcaagcaatttcgagcgcctcctctggtttctcgccattaaa
gtctttggcggagacggagatattcatctacagcggcaaagagccagcgatatcgtccgc
agatggcttggcgatctgcaaactcaaggcggcttcagagttgagccagccgttcttgat
gctgccaaagaacatttcgaatctgagcgtgtctccgatttggaaaccatcgacactatt
cgcgacatctactcctcttgtttccccgcctccccagttagtagcggaacaagaggcagc
acgggtggatacatccttgatccacactccgctgttggagttgctgcttcccttcgatct
attgatcgcaaccctggcacacatcatatttctctgtcaacggcacacccagcaaaattc
gtttcagctgttgatatggcgctaggaggccaggatggctacgagtttgacaacattgtt
ccaccggagtttgcggggttgttgaggaaagagcgccgtgtgattgaggttcctgcggga
gaagggtggaaggccgtgagcaaaattatcgacgcaaatgttaagttgtag

DBGET integrated database retrieval system