KEGG   Ajellomyces capsulatus: HCAG_01084Help
Entry
HCAG_01084        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
aje  Ajellomyces capsulatus
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:aje00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    HCAG_01084
   03420 Nucleotide excision repair
    HCAG_01084
   03430 Mismatch repair
    HCAG_01084
   03440 Homologous recombination
    HCAG_01084
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 247 aa AA seqDB search
MVRKVAWAEGVSQAVKEVAKEAGYMKNSLRPVTIKQTLDATQAHGDADFKIDGTEVSQVT
FVGQVRAVSHLTTFVTYKLDDGTGEIEVKLWLEKNAVNPTGDDMDTGDAPRSSESEIPIN
GYAKVWGKLNNFNNRRNFVAHVIRPITNIDEYNCHFLEATAIHLYYTRGPVGGHLGNERP
LPGATHPSGGGPLAGKTLPPMSPLARKMYETLSNTPQSNEGLHVQHLASLMGLPVGRDDS
TLAILEY
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgcaaggtggcatgggcggagggggtttcacaggcggtgaaggaggtagccaag
gaggcaggctatatgaaaaactcgcttcgtcctgtgacaattaagcaaacgctggatgcg
acccaagcgcatggagatgcagattttaaaattgatggcacggaggtatcacaggtaacc
ttcgtcggccaggtccgcgctgtcagccaccttactacatttgtcacttataaacttgac
gacggcacgggggaaattgaagtaaaattatggctcgaaaagaacgcagtcaatcccaca
ggagatgatatggatacgggagatgctccacgctcctcggaatcagaaattccaatcaac
gggtacgccaaagtttggggaaaacttaataacttcaacaatcgacggaatttcgtcgcg
catgtcatccgccctataacgaacattgatgaatacaattgccattttctcgaagccaca
gcgattcacctatactatacgcgaggcccagtagggggccatctggggaatgagaggccg
ctccctggtgcaacacatcccagcggtggtggtcctctcgccggaaagactttgcctcca
atgtcgccgctggctcggaagatgtatgagactttgagcaacacgccacagagcaacgaa
ggactccacgtgcaacacctggcgtcactgatgggtttgcctgttggccgagatgacagc
accttggcaattctagagtattaa

DBGET integrated database retrieval system