KEGG   Ajellomyces capsulatus: HCAG_01084Help
Entry
HCAG_01084        CDS       T02229                                 

Definition
(RefSeq) hypothetical protein
  KO
K10739  
replication factor A2
Organism
aje  Ajellomyces capsulatus
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:aje00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    HCAG_01084
   03420 Nucleotide excision repair
    HCAG_01084
   03430 Mismatch repair
    HCAG_01084
   03440 Homologous recombination
    HCAG_01084
DNA replication proteins [BR:aje03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    HCAG_01084
DNA repair and recombination proteins [BR:aje03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     HCAG_01084
   MMR (mismatch exicision repair)
     HCAG_01084
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     HCAG_01084
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 247 aa AA seqDB search
MVRKVAWAEGVSQAVKEVAKEAGYMKNSLRPVTIKQTLDATQAHGDADFKIDGTEVSQVT
FVGQVRAVSHLTTFVTYKLDDGTGEIEVKLWLEKNAVNPTGDDMDTGDAPRSSESEIPIN
GYAKVWGKLNNFNNRRNFVAHVIRPITNIDEYNCHFLEATAIHLYYTRGPVGGHLGNERP
LPGATHPSGGGPLAGKTLPPMSPLARKMYETLSNTPQSNEGLHVQHLASLMGLPVGRDDS
TLAILEY
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgcaaggtggcatgggcggagggggtttcacaggcggtgaaggaggtagccaag
gaggcaggctatatgaaaaactcgcttcgtcctgtgacaattaagcaaacgctggatgcg
acccaagcgcatggagatgcagattttaaaattgatggcacggaggtatcacaggtaacc
ttcgtcggccaggtccgcgctgtcagccaccttactacatttgtcacttataaacttgac
gacggcacgggggaaattgaagtaaaattatggctcgaaaagaacgcagtcaatcccaca
ggagatgatatggatacgggagatgctccacgctcctcggaatcagaaattccaatcaac
gggtacgccaaagtttggggaaaacttaataacttcaacaatcgacggaatttcgtcgcg
catgtcatccgccctataacgaacattgatgaatacaattgccattttctcgaagccaca
gcgattcacctatactatacgcgaggcccagtagggggccatctggggaatgagaggccg
ctccctggtgcaacacatcccagcggtggtggtcctctcgccggaaagactttgcctcca
atgtcgccgctggctcggaagatgtatgagactttgagcaacacgccacagagcaacgaa
ggactccacgtgcaacacctggcgtcactgatgggtttgcctgttggccgagatgacagc
accttggcaattctagagtattaa

DBGET integrated database retrieval system