KEGG   Ajellomyces capsulatus: HCAG_01084Help
Entry
HCAG_01084        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
aje  Ajellomyces capsulatus
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:aje03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:aje03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:aje03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:aje03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 247 aa AA seqDB search
MVRKVAWAEGVSQAVKEVAKEAGYMKNSLRPVTIKQTLDATQAHGDADFKIDGTEVSQVT
FVGQVRAVSHLTTFVTYKLDDGTGEIEVKLWLEKNAVNPTGDDMDTGDAPRSSESEIPIN
GYAKVWGKLNNFNNRRNFVAHVIRPITNIDEYNCHFLEATAIHLYYTRGPVGGHLGNERP
LPGATHPSGGGPLAGKTLPPMSPLARKMYETLSNTPQSNEGLHVQHLASLMGLPVGRDDS
TLAILEY
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgcaaggtggcatgggcggagggggtttcacaggcggtgaaggaggtagccaag
gaggcaggctatatgaaaaactcgcttcgtcctgtgacaattaagcaaacgctggatgcg
acccaagcgcatggagatgcagattttaaaattgatggcacggaggtatcacaggtaacc
ttcgtcggccaggtccgcgctgtcagccaccttactacatttgtcacttataaacttgac
gacggcacgggggaaattgaagtaaaattatggctcgaaaagaacgcagtcaatcccaca
ggagatgatatggatacgggagatgctccacgctcctcggaatcagaaattccaatcaac
gggtacgccaaagtttggggaaaacttaataacttcaacaatcgacggaatttcgtcgcg
catgtcatccgccctataacgaacattgatgaatacaattgccattttctcgaagccaca
gcgattcacctatactatacgcgaggcccagtagggggccatctggggaatgagaggccg
ctccctggtgcaacacatcccagcggtggtggtcctctcgccggaaagactttgcctcca
atgtcgccgctggctcggaagatgtatgagactttgagcaacacgccacagagcaacgaa
ggactccacgtgcaacacctggcgtcactgatgggtttgcctgttggccgagatgacagc
accttggcaattctagagtattaa

DBGET integrated database retrieval system