KEGG   Ajellomyces capsulatus: HCAG_01140Help
Entry
HCAG_01140        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
aje  Ajellomyces capsulatus
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    HCAG_01140
  Lipid metabolism
   00062 Fatty acid elongation
    HCAG_01140
Enzymes [BR:aje01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     HCAG_01140
Lipid biosynthesis proteins [BR:aje01004]
 Fatty acid synthase
  Component type
   HCAG_01140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 312 aa AA seqDB search
MRFPVSLALILSQLAIHASAVSKRQPEQNILRKGPIPLVIWHGLGDDYGSSGIHNISNLA
QLVHPGTYVYVISLGSSRATDLRASYFGNLNEQLEEVCNKLGTEQILSTAPSINALGFSQ
GGQFLRAYVERCNFPPVHNLVTFGSQHNGISSFQGCSTTGDWLCRAGESLLRWDMDQYRA
YSNFLADINNERASKNVTYKENMAKLNKFAMYMFENDKMMVPKESSHFAEVNTTDGTVTP
LRERRIFKEDWLGLRELDTKGKLDLKMTPGGHMELTDETLRTVFQEYFAPIELGGDVHAM
PTDADTQKVLSG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttccccgtatcattagccctaatcctctcccaactggcaatacatgcctccgcc
gtctcgaaacgccaaccagaacaaaacatcctcaggaagggccctattcccctagttata
tggcatgggctaggcgatgactacgggagcagcggcatccacaatatctccaaccttgcc
cagctggtccacccaggaacctacgtctacgtcatctcccttggcagttcacgcgcaaca
gacctccgggccagctatttcggcaacctcaacgagcagttagaagaagtttgcaataaa
ctaggtacggagcagatcctcagtaccgctccctccatcaatgctttgggcttctcgcag
ggcggccagttccttcgtgcatatgtcgagcgctgcaacttcccacctgtccacaacctc
gttaccttcggcagtcaacataatggtatctcaagcttccagggctgcagcaccaccggt
gattggctgtgtagagctggggagtcgctgctacgatgggatatggatcagtatcgtgcc
tacagcaatttcctggcagatattaataacgagcgcgcttcgaagaacgtgacgtataag
gagaacatggcgaagttgaataagtttgctatgtacatgttcgagaatgataagatgatg
gtgccgaaagagtcgtcgcatttcgcggaagttaatacgacggatgggacagttacgcca
ctaagggaaaggaggatattcaaggaggactggcttgggttgagagagttggatacaaag
gggaagttggatcttaagatgaccccaggtggtcatatggagcttaccgatgaaacactg
cgcacggtcttccaggagtattttgcgcctattgagctgggtggtgatgtgcacgcaatg
cccacagatgcggacacgcagaaagtgctatcggggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system