KEGG   Ajellomyces capsulatus: HCAG_01158Help
Entry
HCAG_01158        CDS       T02229                                 

Definition
similar to dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
aje  Ajellomyces capsulatus
Brite
Enzymes [BR:aje01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     HCAG_01158
Protein kinases [BR:aje01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [Table]
   HCAG_01158
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 271 aa AA seqDB search
MTCSKRKDFETSAKELEELRRRASPKERVGPGQALKMASLNIFEKGEIIDFKDIYFCGTH
KAKKHVSDLSAQAANFGYDDERGDYNIVVRCVDHKTGSLVAVKIIRNKKRFHQQALVEVN
ILQKLKEWDPHRRHSVVNFTQSFYFRGHLCISTELLGMNLYEFIKAHDFRGFSLKLIRRF
TKQLLSTLVLLHKNKVIHCDLKPENVLLAHPLHSEIKVIDFGSSCFENEKVYTYIQSRFY
RSPEVILGMSYANYFWTRFVDDTAAPQSPIP
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgacttgcagtaaacggaaagattttgagacttctgctaaagagttggaagaattgcga
cgtagggcaagtcccaaggagcgggttgggccaggccaggctcttaagatggctagcttg
aatatcttcgagaaaggtgaaatcattgattttaaggatatctacttctgcggtacgcac
aaggcgaaaaagcatgtcagcgatcttagtgcccaagctgcaaattttggatacgatgat
gaacgcggcgattacaacatcgtggtccgatgtgttgaccataaaaccggttctctcgtt
gcggtgaaaatcatcagaaataagaagcgatttcaccagcaggcactcgttgaagtaaat
attctgcagaagcttaaggaatgggaccctcaccgacgtcacagcgtagtgaactttact
caaagtttctacttccgtggtcatctgtgtatatcgactgaacttctaggaatgaacctg
tacgagtttatcaaagctcatgacttccgtggattctccctcaagctcatccgccggttt
acgaagcagttgctcagtactttagtccttttacataagaacaaggtcattcactgtgac
ttgaaaccggaaaacgtacttctagcacaccctttgcattcagaaataaaggtgatcgac
tttggctccagctgttttgaaaacgagaaggtgtacacgtacattcagagtcgcttctac
cgctcccctgaagttatattgggcatgtcatacgcgaattacttctggacccgcttcgtc
gacgatacggccgctccccaatcccccatcccttag

DBGET integrated database retrieval system