KEGG   Ajellomyces capsulatus: HCAG_01159Help
Entry
HCAG_01159        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
aje  Ajellomyces capsulatus
Brite
Enzymes [BR:aje01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     HCAG_01159
Protein kinases [BR:aje01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   HCAG_01159
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 648 aa AA seqDB search
MPLQKSMPQRTPQSKSSNLPPHTDDSGSGGRHLPVQQKSSASAKTQAAKTNRQVQAVEGP
PSRRMQKNSSSGSITTDSSNSSSLPFRNNTEQRPGGAQTRRRQSIREQNTTIGPRNGDPV
KRAFTNYSNPQTYSENPSTQPSTSHEHTGNSSSRLSFGSATASGSLKDESPTPPENSEFL
APISFDDFHNSIMSKEPSLSHFPLPMASSYDLKPPAPRSTPRWSSQQPPQNGNHVRTGQL
ARRESNASRSTVGSVTGVNGNTQPQGTTASRPRRLSHAPPPSSTASTSRPPRKSIGPGSL
ISDNGDRVAPRRRPSLSARKVSDANRPDQPNFNPQNFDVGGPSESTMFLNTPRYQKAKSL
QPPSRITRDSRDSLFVPSTGPEPLRSSSNNAVRTPAKTGLNRTTTPSSSKRISVMPPHAH
GLGARTISPTDARRMKRMSLMPQPPPMPHTPPTQQNIVLPRPRSSAQSPSMIPRKSVTPS
SSRTTPDPHRKSYSSGISLSSNTSYNSARNSNGSLQPRLSQNISTSRLPTPKPRADNASN
NDEEEVPPVPAIPKAYESPKTEGEVQLPPARKSSLPSETGSLRDSLKLNSGSFETPSKGP
TIDDFHVARPVVHRMESKPRPVSNIGSQKSPTIEAPTTQFIASKRSYD
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgccgttacagaagagcatgccgcaacggactcctcagtcaaaatcctccaatctgcct
ccccacaccgatgattctggctctggaggtaggcatttgcccgttcagcaaaagtcatcc
gcttcagccaaaacacaggctgcgaagactaacaggcaggtgcaagcagtggagggtcct
ccgtcacgaaggatgcagaaaaattcgtcctcaggtagcatcacgacggatagctccaat
tccagttcgttgccttttaggaataacacggagcagcgccctggtggtgcccaaactcgc
cgaagacaatcgattagggagcagaacacgacaattggcccgcgaaatggagatcctgtg
aaacgggcgttcaccaattattcgaatcctcaaacgtattccgagaacccttccacacag
ccctccacgtctcacgaacacacgggaaactcaagctctcgtttgagttttggctcagca
acagctagtggttcattgaaggatgagagtccgactccccccgagaacagcgagttcctc
gcgccaatcagtttcgacgatttccataatagtatcatgtcgaaagaaccaagtttaagt
catttccctcttcctatggccagcagttatgatttgaaacccccggctccaagatcgacg
ccgaggtggtcaagccaacagccaccgcaaaatgggaaccatgtgcggacaggccagctg
gcccgaagagaaagcaatgcttcacggagcacagtggggagtgtaacaggagtaaatgga
aatactcaacctcaaggaactactgcatctcgtccgcgtcggctaagccacgctcctcct
ccatcttctactgcttcaacgtcgcggccgcctaggaaatctattggaccgggtagcttg
atatctgacaatggagatcgcgttgctccgcggcgaagaccaagtttatcagcaaggaaa
gtctcggatgcaaatcgtccagaccagccaaattttaaccctcaaaactttgatgttggt
ggtccttccgagtctacaatgtttctaaatacacctaggtatcaaaaagcaaaatcgttg
caaccaccttcccgaataaccagggatagtagggatagcctgtttgttccatctactggg
ccagaacccttgaggtcttcgtcaaataatgctgttcgaactccagccaagactggacta
aatcggacaactacaccctcgtcatccaagcggatttctgttatgccaccacatgctcac
ggcttaggggcacgaacgataagccctaccgatgctaggcgtatgaaaagaatgtcgctg
atgccccaaccgccgcccatgccacatactcctcccacacagcaaaacattgtgcttccc
agacctcgttcttctgcccagtctccttccatgataccgaggaaaagtgtcaccccttcc
tcttcaaggaccactcctgatcctcatcgcaaatcctacagttcggggatttcattatca
tccaataccagttacaattctgctcggaattcaaacgggtccttgcaacccaggctttcg
cagaatatttctacctctagattgccaactccgaaaccacgtgcagacaacgcctccaat
aacgatgaggaagaagtcccaccggttccagcaattccgaaggcatacgaatcgcctaag
actgaaggagaagtccaattgcctcctgctcgaaaatctagcctgccgtctgaaaccgga
tcactcagagatagtttaaaattgaattctggtagctttgaaactcctagcaaggggcct
acaatagatgactttcatgttgcgagaccagttgtccataggatggaatctaaacctcga
cctgtttcaaacattgggtcgcaaaaatctccaaccattgaagctcccaccactcaattt
attgcctctaagcgttcctatgactaa

DBGET integrated database retrieval system