KEGG   Ajellomyces capsulatus: HCAG_01197Help
Entry
HCAG_01197        CDS       T02229                                 

Definition
similar to protein O-D-mannosyltransferase
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
aje  Ajellomyces capsulatus
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:aje00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 845 aa AA seqDB search
MASKSAKGGLEVKPQNRNRRSPSRSPGHRNRKKAAASKKLDYSSEGISDYDVLQLPVSDC
KTVLLLTAVSVVVRLFRIYQPTSVVFDEVHFGGFATKYINGKFFMDVHPPLAKMLIALVG
YLAGFRGDFDFKEIGKDYLEPGVPYVAMRMLPAIMGIMAVPTMFLTLKAYGCRTSTASMG
ALLVTFENGLVTQSRFILLDSPLIIFTALTALAFTNFTNQHEQGPSRAFGASWWFWLTLT
GIFLGATVSVKWVGLFTIAWVGSLTLVQLWVLLGDTRTVTIRVWFKHFFARAFCLIVIPV
GFYMAMFAIHFLCLSNPGDGDGFMSSEFQATLSSKKMQDVPADVAFGSRVTIRHHNTQGG
YLHSHNSMYPEGSKQQQITLYPHKDENNIWIMENQTQPLGEYGEIEGPSAWDNLTANHVI
DGSVIKLYHTSTQRRLHSHDVRPPVTEEEWQNEVSAYGYEGFAGDANDLFRVEIVRSMSD
GDEAQKRIRTIKTKFKLVHVMTGCVLFSHKVKLPAWGFEQQEVTCAKGGSLPNSIWPLPR
YGGNAAAHDYKNVTFKRFDYEIGQTVLGWAFHYFPFYLMARQLFLHHYFPSLYFAILAFC
QVIDYGVNRISLSGMVSSKRVIGKIFMVLFVVLSIVTFTMLSPLAYGNPWTKAACRRVKL
LDSWDFDCNLFHNDLADYQKASFVGGTTKSVQAMPTPESQQQQQRVVDQAEGEDNAALVT
PVQNLASTHLDSVVYRDQHGNVLNEEEVAMLEKNGIVSFETRYETKTRIIDAQGREINGE
QLAPSHPDAEGQNPETEGQGGTVGEVPINKPASVPGDEKSVEREDDGFCFGDMLIKKCFS
TILLH
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atggcctccaagtctgcaaaaggtgggctggaggtgaagccccagaaccgtaaccgtcgt
tcaccatcccgatcccctggtcataggaatcggaaaaaagctgcggcgtcgaaaaagctt
gactacagctctgaagggatttcggattatgatgtacttcagttgccagtttcagattgt
aaaaccgtgttgttgttgacggctgtatccgttgtggtccggctgttcaggatctaccag
ccaacaagtgtggtattcgatgaagtgcacttcggtggatttgcgaccaaatatatcaat
ggaaagtttttcatggacgtacatcccccgctcgcgaaaatgctcatcgcccttgtcgga
tacctggctggatttcgcggtgacttcgacttcaaagaaatcgggaaggattatttggag
cccggggttccatacgtagctatgcgtatgctgcccgcaataatgggtattatggctgtc
ccaaccatgtttcttacgttgaaggcatatgggtgccgaacatccacggcttctatgggc
gcgcttcttgttacgtttgagaacggtcttgttacccagtcacgctttatactcctcgat
tcacctttaatcatatttacggccctaactgccctcgcctttacaaattttacaaaccaa
catgagcaaggtccatcgcgagcatttggggcctcctggtggttttggcttacacttaca
ggcatcttcctgggtgctactgtcagtgtaaaatgggtggggctttttacgatcgcgtgg
gttggaagcctgacactcgttcaactctgggtactcctcggtgatactcgaacagtgacg
atccgtgtgtggtttaaacacttctttgctcgagcattctgcctcattgtcattcccgtc
gggttctacatggccatgtttgcgattcactttttgtgcttgtccaacccaggggatgga
gatggcttcatgtcttctgaattccaagcgaccctcagttccaaaaaaatgcaggatgta
ccagctgatgtagcgttcggttcgagggttaccatccgccatcacaatactcagggagga
tatttgcattcgcataactctatgtatcccgagggcagcaagcagcagcagattactcta
tatccccataaggatgaaaacaacatctggatcatggaaaaccaaactcagccattgggt
gaatatggagaaatcgagggaccatctgcctgggataacctgactgctaaccacgtcata
gacgggtcagtgatcaagctctatcacacaagcactcaacgaagacttcattcacatgat
gtacgcccacccgtaacggaagaggaatggcagaatgaggtatctgcttatggctatgaa
gggtttgccggtgatgcgaacgacttattccgcgttgaaattgtccgatcaatgtccgat
ggtgacgaagcgcagaagcgcatccgcacaattaagacgaaattcaaactcgtccatgtg
atgacaggatgcgttctattttcgcacaaggtgaagcttccagcatggggctttgagcag
caggaagttacatgcgccaaaggtggctccttacccaatagcatttggccattgccacgc
tacggtggcaacgcagctgcccatgattataaaaacgtcaccttcaaacgattcgattat
gagattggccaaactgttctaggatgggctttccactacttccctttctatcttatggcc
cgccaactcttccttcatcactatttcccgtctttatactttgccatccttgcattctgt
caggtcatcgactatggcgtcaacagaatcagtctctctggcatggtgagcagcaaacgt
gtaattggcaagatattcatggtgctcttcgttgttttgtctattgtgactttcaccatg
ctctcgcccttggcgtatggtaacccttggactaaagctgcatgccgcagagtcaagctt
cttgattcttgggattttgattgtaatctcttccataatgatctagctgattatcagaaa
gcgagctttgtcggtggaactacaaaatctgtacaggcaatgccaactcccgagtcgcaa
cagcagcagcaaagggttgttgaccaggcggaaggagaagacaatgctgcattggtgacc
cctgtacaaaacctagcatctacccatctcgactcagtggtatatcgtgatcagcatgga
aatgttttgaatgaagaggaagttgcaatgctggagaaaaatggcatcgtttcatttgaa
accagatatgaaaccaagacacgaataatcgatgctcagggtcgcgagattaatggggaa
caactagccccttcccaccccgatgcggagggacagaatcccgaaacagaaggccaaggc
ggcacggtaggtgaggttcccattaacaaacctgcatccgtccctggtgatgagaaatcc
gtagaacgggaggacgatggtttttgttttggagatatgctgatcaagaaatgtttcagt
accattctcttgcattga

DBGET integrated database retrieval system