KEGG   Ajellomyces capsulatus: HCAG_01200Help
Entry
HCAG_01200        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
aje  Ajellomyces capsulatus
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:aje00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 683 aa AA seqDB search
MTGDDGGVELEKEEQNQKITKKEKEKQLGKNELGKRAASSKGKGSSENGSRRRSSRLVLL
EKTNEMVGKASPVPGKRSRGAMLKGKDRLKVINRRASLRPRDVVCEKAAPSTRPPSTADG
PVLKKRRVSEGDAVVPKKSSDTSAIDDTRPPKRTTQKKWLSHGLYAGQDRYFDPRLTEEK
NRLKFGKQNAEDRKKAFPLPMFAGERLIEDGRDFKLPFDIFSPLPPGQPKPDEWRKTNKN
VFVGDAACIWKAIKLRERSTCMCTPELGCDENCQNRYMFYECDDNNCKLGAELCGNRSFE
GLRQRIKMGGRYNIGVEVIKTADRGYGVRSNRTFAPNQIIVEYTGEIITQEECERRMRTV
YKDNECYYLMYFDQNMIIDATRGSIARMEKWTVAGKPRMALFAGENGIMTGEELTYDYNF
DPYSQKNVQQCRCGVPTCRGVLGPKSKDSNRPRSEKQTNSNLSQEPRKISAVGKKRKREK
VLDESSTSHLNKRKKILKPASKALKPSIKKAVASTRPATNSNKRAKAKPNPKTKTSTITT
IKANSVPTKKSTVRPRATISRTIPAKQKTQRSAAKTPSQTQPQGNTKLNRPSKKLNSISA
ARAASRTPAAMRRFLEAGKMNHKKEDDAKETTSLSSRSLTSKTKAGVPVTQRRYTMNNPG
KQSKISKTVKRMVGTMRRGRKSA
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgacgggggatgatggtggtgttgaacttgagaaggaagagcagaaccaaaagatcacg
aagaaggagaaggagaagcaattgggcaaaaacgagttggggaaaagagctgcgagcagc
aaagggaaaggaagtagtgaaaatgggtctcggagacggtcttcgcgtttggtcctgttg
gagaaaactaatgagatggtggggaaagcttcgccggtacctgggaagaggtcgcggggg
gctatgttgaagggtaaagatagactgaaggtcataaatagacgggccagtctacgcccg
agggatgtcgtatgcgagaaggctgctccctcaactaggcctccatctacagctgatggc
ccggttttgaagaaacgacgcgtgtctgagggtgatgctgtggtccccaaaaagtcatcc
gataccagtgccattgacgatacgcggccgcccaagcggacaacgcaaaagaagtggctt
tcgcatggtctatatgcggggcaggatcgttactttgatcccaggcttacagaggagaag
aaccggcttaaatttggaaaacagaatgcagaggacaggaagaaggctttcccattgccg
atgtttgcgggagagaggctgattgaggatggcagagatttcaagttgccttttgatata
ttctcaccactaccccctggccagccgaaaccggatgagtggcggaagactaataaaaat
gtattcgtcggcgatgcggcttgcatatggaaagcgatcaaactcagagagcgttctaca
tgcatgtgtactcctgagttaggttgtgatgagaactgccagaatcggtacatgttctac
gaatgtgatgacaacaactgtaaactgggcgctgaactgtgtggcaatcgaagtttcgaa
gggctgcgccagcgcatcaagatgggtggcaggtataacattggcgttgaggtaatcaaa
acagcggaccgtggatatggggtacgcagcaatcggacttttgcgcctaaccagataatt
gtggagtacaccggtgagattatcactcaggaggagtgtgagaggcgcatgaggactgtg
tataaggataatgagtgttattatcttatgtattttgatcagaacatgatcatcgatgcc
acccggggttccattgcccggatggaaaagtggacagttgccggaaaaccgcgcatggcc
ctattcgctggtgaaaatgggatcatgactggagaagagctcacctacgattacaacttc
gatccctattctcaaaaaaacgtacagcaatgccgctgtggagtgccgacatgtcgtggc
gtgttgggccccaagtctaaagactctaataggccgcgcagcgagaagcagacaaattca
aatctgtctcaagagccaaggaaaatttcggcagtgggcaagaagcggaaacgggagaaa
gtcctcgacgaatcctccacgtcgcacctcaacaaaagaaaaaagattctcaagccagca
tcgaaagcactcaagcctagcatcaagaaagctgtagccagcacccgaccagccactaat
tcaaacaaaagggcgaaagcgaaaccaaatcccaagaccaaaacctctactattactact
atcaaagccaattcagttccaactaagaaatctacagtcagaccccgcgccacaatatcg
agaacaatccctgcaaaacagaagactcagagatctgcggcgaagaccccatcccagacg
cagccgcaaggcaacacgaagctcaaccgaccttccaaaaagctgaactccatttctgct
gcacgcgccgcaagtaggaccccagctgctatgagacggttcctggaagcagggaaaatg
aatcataaaaaagaagacgacgcgaaggaaaccacatccttgtcttctcggagtttaact
tcgaagacaaaagctggagtgcccgtgacgcagaggagatatacgatgaacaaccctgga
aaacagtctaagattagtaaaactgtgaagagaatggttgggaccatgagacggggtaga
aaatctgcttga

DBGET integrated database retrieval system