KEGG   Ajellomyces capsulatus: HCAG_01549Help
Entry
HCAG_01549        CDS       T02229                                 

Definition
similar to glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
aje  Ajellomyces capsulatus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    HCAG_01549
Enzymes [BR:aje01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     HCAG_01549
Exosome [BR:aje04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HCAG_01549
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 518 aa AA seqDB search
MIRDYVLKHVLSTNLDSGSSPQKASKPADQPPQQGSGRYIGAIDQGTTSSRFIIFDAEGN
PVASHQVELSRICQHSGWHEQDPGEIVSSVEKCIDQATRAFTSLGFSVRDLQTIGLASQR
ETTIVWDWETGKPLHNAIAWPDTRTTSLVRELKSKEGADKLQEICGLPLSTYSSATKLVW
LLRNIPDVKKAYDDGRLAFGTVDTWLVYNLNGGNKSNVFVTDVTNASRTMFINLHSLKYD
ETLLNFFEIDQSKIKLPKIVASAHESAFGSMANGPLSGIKITSCLGDQSAALIGHCAFSP
GQAKNTYGTGCFLLYNVGKSPANRLYMLWKEALLLLEVGDARKINDEAATVPDSGGCVFV
TAFSGLLAPYWIDDAKGTIFGLSQHTQRGHIARATLEAVCFQTKAILDAMGKDSGEKLKE
LAVDGGLSASDICMQSQSDIIQLPISRPEMHEITALGAAIAAGYAIGIFKDLEALRGTNK
SRRSTIFKPEIAESESARMYKQWSKAVEMSRGWLDNAV
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgatacgcgattacgtcctcaagcacgtcctatccacgaacctcgattctggaagcagc
ccccagaaggcatcgaaaccagccgatcaaccacctcaacaagggtcaggtcgatatata
ggtgcaatcgaccaaggtaccacttcatcgaggttcattatctttgatgctgaagggaat
ccagtcgcttctcatcaagtggagctaagtcgcatctgccagcattctgggtggcatgaa
caggatcctggagagatagtctcctcggtagagaaatgcattgatcaggcaactagagcg
ttcacttctctaggcttctcggtcagggacctccagactattggccttgccagccaacgc
gaaaccacaatcgtatgggattgggagaccggaaaacctctgcataatgcgattgcatgg
ccagacacgcggaccacctcactggttagagaactgaagtcaaaagagggagcagacaaa
ctgcaggagatttgcgggcttccactctccacctattcctccgctaccaagctggtttgg
cttcttcgcaatatccctgatgtgaaaaaggcatacgacgacggccggttagcattcgga
actgttgatacttggctcgtctacaatctaaacggcgggaataagagtaacgtctttgtc
acagatgtgaccaacgcctctaggactatgttcataaacctccattctcttaaatatgat
gagacattgcttaacttctttgagattgaccagtcgaaaataaaactccccaaaattgtt
gcgtctgctcacgaatcggcatttgggtcaatggcgaatggtcccctgagcggtatcaaa
atcacgagctgccttggagaccaatctgctgcattgattggccactgtgctttctctcct
ggccaagctaagaacacttacgggactggctgcttcctcctctataatgtgggcaagtcg
ccggctaatcgcctgtatatgctttggaaggaagcattgctgttgctggaagtgggggat
gcgagaaaaatcaatgacgaagccgccacggtgcccgattcgggtggatgcgtattcgtt
actgccttcagcggattgcttgccccttactggatcgatgatgcaaaaggcacaattttc
ggcctctcgcagcatactcaacgaggccacatagcccgggcaaccctggaagctgtgtgt
ttccagaccaaagcaattctagatgctatgggaaaagacagcggcgagaaactgaaggag
ctggcagtcgacggcggcttgtcagctagtgacatatgtatgcaatcccaatcggatatt
attcagctgcccatttcacggccagagatgcacgagattaccgcacttggtgcggctatt
gcggcgggatacgcgattggcatcttcaaagacctagaggctttacgaggaacgaacaag
tcgaggaggtcgacgatcttcaaacccgaaatagctgagtcagaaagcgcgaggatgtat
aaacaatggtcaaaagctgtcgaaatgtctcgaggttggctagacaatgcagtctag

DBGET integrated database retrieval system