KEGG   Histoplasma capsulatum: HCAG_01606Help
Entry
HCAG_01606        CDS       T02229                                 

Definition
(RefSeq) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aje  Histoplasma capsulatum
Pathway
aje00010  Glycolysis / Gluconeogenesis
aje00620  Pyruvate metabolism
aje00640  Propanoate metabolism
aje00680  Methane metabolism
aje01100  Metabolic pathways
aje01110  Biosynthesis of secondary metabolites
aje01130  Biosynthesis of antibiotics
aje01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HCAG_01606
   00620 Pyruvate metabolism
    HCAG_01606
   00640 Propanoate metabolism
    HCAG_01606
  Energy metabolism
   00680 Methane metabolism
    HCAG_01606
Enzymes [BR:aje01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HCAG_01606
Lipid biosynthesis proteins [BR:aje01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HCAG_01606
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 5450148
NCBI-ProteinID: XP_001544559
UniProt: A6QW49
AA seq 669 aa AA seqDB search
MSDGPVTPPKAPVVVEAHEVDTFHVPKAFLEKHTTRTHIANLDEYQKLYEESIRDPDTFW
SRLARELITFEKDFDTTRYGSFAGGDVAWFLGGRLNASYNCVDRHALKDPNKVAVIYEAD
EPNEGRTITYGELLKEVSRLAWVLKQAGVRKGDTVAIYLPMIPEAVIAFLACVRIGAVHS
VVFAGFSSDSLRDRVLDAKSRIVITTDEGKRGGKLIGTKKIVDEALRQCPDVTNCIVYKR
TGADVPWTKGRDLWWHEEVEKYPNYIAPESMDSEDPLFLLYTSGSTGKPKGLMHTTAGYL
VGAAATGKYVFDIHNSDRFFCGGDVGWITGHTYVVYAPLLLGCATVVFESTPAYPNFSRY
WDVIDKHQVTQFYVAPTALRLLKRAGNDYIHHKLKSLRILGSVGEPIAAEVWKWYFEIVG
KEECHLVDTYWQTETGSHVITPLGGITPTKPGSASLPFFGIEPAIIDPVSGEEIKGNDVE
GVLAIKQPWPSMARTVWGAHKRYMDTYFNIYKDFYFTGDGAGRDHDGYYWIRGRVDDVVN
VSGHRLSTAEIEAALIEHSAVAEAAVVGIADELTGQAVNAFVALKTTSDNIEQLRKDLIM
QVRKSIGPFAAPKAVFIVDDLPKTRSGKIMRRILRKILSGEEDSLGDISTLSDPSVVAKI
IEVYHASKK
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatggtccagttacgcctcccaaggcaccagtagttgtcgaagcccacgaggtg
gacactttccacgtgcccaaggctttccttgagaagcatactacaagaacccatatagca
aacctggatgagtatcagaagctctatgaagaatccatccgtgaccccgatactttttgg
tcacggctggcccgtgaactcatcacattcgaaaaggatttcgacaccacccgctacggg
tcttttgcgggaggagacgttgcgtggttccttggtggacgtttgaacgcatcgtacaac
tgcgtcgaccgtcatgctctgaaggatccaaataaggtggctgtaatctacgaggctgat
gaacccaatgaaggtcgcactattacatatggcgagcttctgaaggaggtctctcgactg
gcctgggtgctgaagcaggctggtgttcggaagggggataccgtggctatttacctgcca
atgatccccgaagccgtaattgcgttcctggcatgcgttcgtattggtgcagtccactct
gtcgttttcgctgggttctcatcagattccctccgcgaccgcgtcttggatgccaagtca
agaatcgtcattaccacggacgaggggaaacgaggtggaaaattaatcggaaccaagaag
attgttgatgaagcccttagacaatgccctgacgtcacgaattgcattgtttacaagaga
acaggcgctgatgtgccatggacaaagggcagagatttgtggtggcatgaagaggttgag
aagtatcccaactacattgctcctgagtcaatggactctgaggaccctctcttcctactg
tacacatccgggtcgactggaaagccaaagggtctgatgcacacgacagccggttatttg
gtcggtgcagccgctactggcaaatatgtgtttgatattcacaactcggaccgcttcttc
tgtggcggtgatgttggttggattaccggacacacctatgtcgtgtatgctcctctgctt
cttggatgtgcaactgtggttttcgagagcacaccggcctatcctaacttctcccgttac
tgggatgttattgataaacaccaagtgacccagttctatgttgcgccaacagctttaagg
cttctgaagcgtgctggaaatgactacatccaccacaagctcaagagccttcgtattttg
ggatctgttggcgagccaattgcagcggaggtgtggaaatggtatttcgagatcgttggg
aaggaggaatgccatcttgttgacacctactggcaaactgagactggttctcacgttatc
acccctttgggcggcattacaccaacaaagcccggcagtgcttcgcttcccttcttcggc
attgagcctgccatcattgacccggtatctggagaggagatcaaaggcaatgacgttgaa
ggcgttctagcgattaaacaaccatggccaagcatggcgcgcacagtctggggtgcccac
aagagatatatggacacttatttcaacatctacaaagacttctactttaccggcgatggt
gctggacgtgaccatgacggatactactggatccgaggtcgtgttgacgacgttgtcaac
gtttccggccaccgtctgtcaactgcagaaattgaagctgctcttattgaacactctgct
gtggctgaagccgctgtcgttggtattgccgacgaactcaccgggcaggcggtcaatgcg
tttgtcgccttgaagaccacgagtgacaatatcgaacaactccgcaaggatctcatcatg
caggttcgcaagtcaattgggccgtttgccgctcccaaggctgtattcatcgtcgatgac
ctgcccaagactcgcagtggtaaaatcatgcgaagaatcttgagaaagattcttagcggc
gaggaggatagcttgggtgatatctcgactctctctgatccgagtgttgttgcgaaaatc
atcgaggtttaccacgcttcaaagaagtag

DBGET integrated database retrieval system