KEGG   Ajellomyces capsulatus: HCAG_01797Help
Entry
HCAG_01797        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
aje  Ajellomyces capsulatus
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    HCAG_01797
Enzymes [BR:aje01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     HCAG_01797
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 505 aa AA seqDB search
MTIDTALDAGDNGMASVTDGLLQSNSENSATLPVGRNVFLTLTDDALILADKGIKSKSQR
CCRSFPIPGSASQSIPYFNILWVELSDDYITIKYADQVTKKDVTLRSVKYSVNLENKSKA
KTWTQELLDSAYGKAQRQKRIKVLINPFGGKGHAPRDYLRYVEPIFAAAKCQVDVESTSH
RGHAVDIVEKLDVNAYDVVVACSGDGIPYEIFNGLAKKPNASEALRKIAVAHIPCGSGNA
MSWNLNGTGRASLAAVSIVKGLRTPLDLVSITQGDKRTVSFLSQSFGIIAELDLGTENIR
WMGSARFTYGFLVRLLGKPVYPCDLAIKVELDNKELIKDHYRAGSQRRSLDQLRDEESSD
AVGLPPLRYGTVNDPLPDGWTLVPHDKLGNFYAGNMAYMAADTNFFPAALPNDGCMDLIT
VNGDISRRTAIQMLMSVDDGAFFDMPEVNVRKVTGYRVIPRDRKEGYISIDGEQVPFEPF
QAEVHKGLGTVLSKSGYKYETNGLK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgactattgacaccgcactcgatgctggcgacaacgggatggcgtcggtcacggatggc
ctcctccagtccaactcagaaaacagcgcaacgcttcccgtgggaagaaatgttttcttg
actctgacagatgatgcgctcattcttgctgataaaggcatcaagtcgaagtcacagcgc
tgttgccgcagttttccaatccctggctccgcttcgcaatctatcccgtatttcaacatc
ctctgggttgaactctctgacgactatattacgattaaatatgccgaccaagttaccaag
aaagatgtcacccttcgttcagtgaaatattcagtcaaccttgagaataaatcaaaagcc
aaaacatggacccaggaacttctcgactcggcctacggcaaagcgcaacggcaaaagcgc
attaaagtcctcataaacccctttggtggaaaaggccacgccccaagagattacctcaga
tacgtcgagccaattttcgcagccgctaaatgccaagtcgatgtcgaatcaacaagtcac
agagggcacgcagtcgacatcgtggagaagcttgacgtcaatgcatatgatgttgtcgta
gcctgttcgggagatggtataccttacgagatctttaatgggctagccaagaagccaaat
gcgagcgaagctctgcggaaaattgccgtggctcacataccttgcgggtcgggaaacgca
atgagctggaatctcaatggaactggcagggccagtctggccgccgtttctattgtcaag
ggcttgagaactccacttgatttagtctccatcactcaaggtgataaacgcacagtgtca
tttttatcccaatcttttggtattatagctgaattagacctgggtaccgagaatatccgg
tggatgggctccgcgcgattcacatacggattcctggtacgactgcttggaaaaccagtc
tatccctgcgaccttgctattaaggtcgaactcgataataaagaattgatcaaagatcac
taccgcgctggatcccaaagaagaagccttgaccaactacgcgatgaagaatcatcagac
gctgtcggcctcccaccattacggtatggcaccgtgaacgacccgctacccgatggctgg
actctggtgccacacgataaactgggcaatttctacgcgggcaacatggcatatatggct
gcggacaccaacttctttcccgccgcactccccaacgacggatgtatggatctcatcaca
gtgaacggcgacattagtcgacggactgcaatccagatgcttatgtctgttgacgatggc
gcgttcttcgatatgcccgaggtcaacgtgcggaaggttactggctacagggttatcccc
agggaccggaaagaaggatacatcagtattgatggggagcaggtgccatttgagcctttc
caagcggaagtccataaaggacttggaacggtcctatccaaatctggatacaaatatgaa
actaacggattgaagtga

DBGET integrated database retrieval system