KEGG   Ajellomyces capsulatus: HCAG_01813Help
Entry
HCAG_01813        CDS       T02229                                 

Definition
(RefSeq) hypothetical protein
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
aje  Ajellomyces capsulatus
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    HCAG_01813
Enzymes [BR:aje01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     HCAG_01813
Chromosome [BR:aje03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     HCAG_01813
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    HCAG_01813
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 397 aa AA seqDB search
MVIDLTKDSPSEDELDRDVKPLSVGFSGKRDEGFNLLQQFTRPRPRLRTSASVEIALNAR
NSTESMDGVMLNGQNVAVLNNEPSPLHFAVVVPSISSSDTSNKKRRLSSENHLSSPVNGV
LGFPIHHDASELDFNIEFINEYKLQHGVARVEPDFHTGCRCDDKCDLHKCDHLSYEEESE
DRIVPYQMGRGGTIVLRQDFLKRRAMIYECSRLCPCMPGCWNQVVQKGRTVKLEIFRTSN
RGFGLRSPESIQSGQYIDRYLGEVITKKEADAREAAAGDPASYLFQLDFFQEDDECYIVD
GKKYGSITRFMNHSCNPNCKMFPVSQYDAEQKIFDMAFFAIKDIPAGTELSFDYCPNYSI
ESSRYSDPQDVPCLCGEPNCRRKLWPNQRKTMQPEVE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggtcattgatcttacaaaagattccccttcagaagatgaacttgatcgtgatgttaaa
cctttatctgtgggattcagtggcaaacgtgatgaagggttcaatttgctccagcagttc
acgcgtccgaggccacggttgagaacaagtgcgagcgtggaaatagctttgaatgcgagg
aatagcacagagtcgatggatggcgttatgttgaatggccagaatgtcgcggtgttgaac
aacgaaccctcccctcttcatttcgcagttgtcgtaccgtcgatctccagtagcgacaca
agtaacaaaaaacgtcgcctgagctctgaaaaccacctcagctccccagttaatggggtt
ctcggttttcctatccaccatgacgcttcagaacttgacttcaacattgagttcatcaat
gaatataagcttcagcatggggttgcgcgtgttgagccagatttccatacaggctgtcga
tgtgatgataagtgtgatttgcacaaatgcgatcatctctcatatgaggaggagtcggaa
gatcgcattgtgccttatcagatgggtcggggtggaacgattgtcctcagacaggatttc
cttaaacgaagggctatgatatatgaatgctcccggctttgtccttgtatgccaggttgc
tggaaccaggtcgttcaaaaaggacgaactgttaaattagaaatatttcgtacgtcgaac
cgtggcttcggcctacgctccccggaaagtatacaatcaggtcaatacattgataggtac
ctaggcgaggtaataaccaaaaaggaggccgatgcccgcgaagctgctgcaggggatcca
gcgagttacctttttcaacttgacttcttccaagaggatgatgaatgttacattgttgac
ggaaaaaagtacgggtctatcacgcgctttatgaaccattcctgcaaccctaattgcaag
atgttcccggtctcccaatatgacgctgagcagaagatattcgacatggctttctttgct
ataaaagatattcctgcgggaaccgagcttagcttcgattactgccccaactatagtata
gagagttcaagatatagtgaccctcaagatgttccatgcttgtgtggtgagccgaactgc
cgtcgtaaactgtggccaaaccagcggaaaactatgcagcccgaagtggagtga

DBGET integrated database retrieval system