KEGG   Ajellomyces capsulatus: HCAG_01986Help
Entry
HCAG_01986        CDS       T02229                                 

Definition
Poly(A)+ RNA export protein
Orthology
K14298  
mRNA export factor
Organism
aje  Ajellomyces capsulatus
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:aje00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    HCAG_01986
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 345 aa AA seqDB search
MALFGSTTTNTAASNTAGDLSKDVALTSPPEDSISHLAFSSVSDHLAVASWDKKVRIYEI
NEQGQSEGKALFEHEAPVLSCCWAPDGTKVVGAGVDKAARMLDLQANATTPVQVAAHDAP
IRCCAMIQNPGNTAQSLLVTGSWDKTVKFWDLRQATPIGTLECQERVYTMDVKNKLLVIG
TADRYINIVNLDQPTKFYKTMQSPLKYQTRVVSCFTDATGFAVGSIEGRCAIQYVEDKDA
SSNFSFKCHRENPPNTRDVSNVYAVNSIAFHPVHGTFSTAGSDGTFHFWDKDAKHRLKGY
PSVGGTISSSAFNKNGQYLRTPNKVMMHPIVQEEVRPRPGARRTR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggctcttttcggctctacaacaaccaacacggccgcttccaacacagctggcgatctc
tcgaaagatgtcgccctcacctccccccccgaagatagcatctcgcatcttgccttctcg
tcagtgagcgatcatcttgccgtggcgtcttgggacaaaaaagtgcgcatatacgaaatc
aacgagcaaggtcagagtgaaggaaaggcgctttttgaacatgaggcacccgtcttgagc
tgctgctgggctcctgacggcaccaaggtcgttggcgccggcgtcgacaaagctgcccgc
atgctcgaccttcaagcaaatgccaccacccccgtccaagtcgccgcccacgacgccccc
ataagatgctgcgcaatgatacaaaacccaggcaacaccgcccaatccctcctggtaaca
ggctcatgggacaagaccgtgaagttctgggacctgcggcaggccacgccgatcggcacg
ctcgagtgccaggagcgcgtgtacaccatggacgtgaagaacaagctcctcgtcatcggc
accgcggaccgctacatcaacatcgtcaacctcgaccagcccaccaagttctacaagacc
atgcagtcgccgctgaaataccagacgcgcgtcgtcagctgcttcacggacgccacgggc
ttcgccgtcggctccatcgagggccgctgcgccatccagtacgtcgaggacaaggacgcc
agctccaacttcagcttcaagtgccaccgcgaaaacccgcccaacacccgcgacgtcagc
aacgtgtatgcggtcaactcgattgccttccaccccgtgcacggcaccttcagcacggcg
ggcagtgatggcacgtttcacttctgggataaggatgccaagcatcgcctgaagggctat
ccgagtgtcgggggcacgatttcgagctccgcctttaacaaaaacgggcaatatcttcgc
acgccgaataaggttatgatgcaccccatcgttcaggaggaggtgagaccccggcccggc
gcaagacggacgagatga

DBGET integrated database retrieval system