KEGG   Ajellomyces capsulatus: HCAG_02007Help
Entry
HCAG_02007        CDS       T02229                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
aje  Ajellomyces capsulatus
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HCAG_02007
Enzymes [BR:aje01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     HCAG_02007
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 200 aa AA seqDB search
MAAAAIRKFRPVVISGPSGAGKSTLIKRLFADYPDTFALSVSHTTRPPRAGEQHGREYYF
TTRDGFQSLIDEGGFIEWAQFSGNYYGTSTKAVRDVAEKKRICILDIEMEGVKQVKRTSL
NARFIFIAPPSLEVLEQRLRGRGSETEESLRSRLAQAKNELEYATQPGAHDMVLVNDELE
ATYKALREWVVDEGRFGALE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgctgccatacgcaaattccgccctgtagtgatatccggcccctcaggcgct
gggaaatcaacattgataaaaagactctttgccgattacccagatacctttgcgctttca
gtttctcatacaacccgacccccccgcgccggcgaacaacacgggcgtgaatactacttc
acaacacgcgatggcttccaatccctcatcgacgaaggcggctttatagagtgggcccaa
ttcagcgggaattactatggtaccagcaccaaggcggtgagggacgtggcggagaagaag
cgcatttgcattctcgatattgagatggagggcgtcaaacaagtcaaacgcacatcccta
aatgcgcgtttcatcttcatcgccccgccctccctcgaagtgctcgagcagcgcctgcgg
ggtcgcggctcggagacggaggagagtctccgcagccgtctggcgcaggcgaagaatgag
ttggagtatgccacgcagcctggcgcgcatgatatggtgcttgtcaatgacgagttggag
gctacgtataaggcgttgagggagtgggtggttgatgaggggcggtttggggcgctggag
tga

DBGET integrated database retrieval system