KEGG   Ajellomyces capsulatus: HCAG_02020Help
Entry
HCAG_02020        CDS       T02229                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
aje  Ajellomyces capsulatus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HCAG_02020
Enzymes [BR:aje01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     HCAG_02020
Exosome [BR:aje04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HCAG_02020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 364 aa AA seqDB search
MSFSSLVADIAFRDGNRDDCSTLTSQGLTSQIGGARSYVSTAATSVSISGDISSQLHAGY
SHPLNRTWQAERQLTKSMLIYPLFITDNPDEETPIPSLPNQHRRGVNRLIPFLTPLVQKG
LRSVIVFGVPLAPNTKDALGTSADDPSGPVIQAIRLIRFHFPDIYIVADVCLCEYTSHGH
CGILRDDGTLNNALSIDRISDVALAYAEAGAHCVAPSDMNDGRVRAIKLKLIEAGIAHRV
LLMSYSAKFSGCLYGPFREAAGSCPSFGDRKCYQLPPGGRGLARRAIQRDIAEGADIIMV
KPASSYLDIIRDAKELGKDMPVAAYQVSGEYAMIHAAAKAGVFDLKSMAIESTEGILRSV
GRGL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttctcctccctggttgcggacattgcattccgagatgggaatcgtgatgattgc
agcacgttgacttctcaaggcttgacatcccaaataggcggcgcacgctcatatgttagc
actgcggcgaccagcgtgagcatatcgggtgacatctccagccagcttcatgcaggctac
agccatcccctcaacaggacgtggcaggccgaacggcagttaacaaagtccatgcttatc
tatccccttttcattaccgacaaccccgatgaagaaacaccaattccctccttaccaaac
caacaccgccgtggggtcaaccgtctcatcccattccttacaccccttgtacaaaagggt
ctacgatccgtaatcgtcttcggtgtccccttagcccccaacacaaaagatgcccttggg
acgtctgcagacgaccctagcggacctgtcatccaagccatccgtcttatccgcttccac
ttcccagacatctacattgtcgccgacgtctgtctctgtgaatacacctcccacggccac
tgcggcatcctccgcgatgacggcaccctcaacaacgccctctccatcgaccgcatctct
gacgttgctctcgcctacgccgaagcaggcgcccactgcgtcgcgccctcagacatgaac
gacggccgcgtgcgagccatcaagctcaagctcatcgaagccggcattgctcaccgcgtt
ctcctgatgtcctacagcgcaaagttcagcgggtgtttgtacggccccttccgcgaagct
gcgggctcctgcccgagcttcggagatcgcaaatgctaccaactgccaccaggtggtcgc
gggctggctcgccgcgccatccaacgcgatatcgcagagggcgcggatatcatcatggta
aaacctgccagcagctacctggacatcatccgcgatgcgaaggagctgggcaaggacatg
ccagtggcggcgtaccaggtgagcggggagtacgctatgatccacgcggcggcgaaggcg
ggtgtgtttgatttgaagtcgatggcgattgaaagtactgaggggattctgaggagcgtg
gggcggggattgtga

DBGET integrated database retrieval system