KEGG   Ajellomyces capsulatus: HCAG_02025Help
Entry
HCAG_02025        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
aje  Ajellomyces capsulatus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 169 aa AA seqDB search
MACIHIDSPDVCLFCFNGGCTGDRNHSSIHHQRSGHPLVLNIRRTRKAVQRDEPPPKMSK
LAITAEREEDRYDTTTRVSCHSCQVSDIEKSAGKLPAVVNGVLKAATFSRKEEVKAWEQE
YKPCQHILSLVQDQSNQTTPKDLCKCSSCDLKENLWLCLECGNLGCGRN
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggcttgcattcatattgattctcctgatgtctgtcttttctgtttcaacggcggatgt
acgggggataggaatcactcaagcatccaccaccagcgctcaggacatccgctcgtgttg
aatatcaggaggacaaggaaagccgtgcagcgagatgaacccccccctaagatgtcgaag
ctagccatcactgcggaaagagaagaagatcgctacgacactaccacgagagttagctgc
cattcttgtcaagttagtgacattgaaaaatctgctgggaaactcccagcggttgtcaat
ggtgtattgaaagctgccacattctcacggaaggaggaagtcaaggcctgggagcaggaa
tacaaaccgtgccagcatatactgtctctcgtccaggatcaatcgaatcagacaacgcca
aaagatctatgtaaatgctcctcatgcgacttaaaagagaacctctggttgtgcctcgaa
tgcggtaatttagggtgtggtcgaaattga

DBGET integrated database retrieval system