KEGG   Ajellomyces capsulatus: HCAG_02220Help
Entry
HCAG_02220        CDS       T02229                                 

Definition
similar to map kinase kinase
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
aje  Ajellomyces capsulatus
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:aje00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    HCAG_02220
Enzymes [BR:aje01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     HCAG_02220
Protein kinases [BR:aje01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   HCAG_02220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 668 aa AA seqDB search
MDGHDLQDAAGNDLRKPPQKSPLISPIPSADAQPPTLRRVGDSPSIMSPSSTPLGLINAA
RKPPTVPPTSTTRSSGLHQDIQAKMKAFSLSRQGARPGLSPQSSSTANPGTGNPTVTSAV
QGGPFVGGIPPTSGRGTPQVVGGPIPPGIGRLPSQTSPGWTPHPPSPNPNSPIQPKMGGL
AAKRGLTRGMKLSDASGPRMDKPTPAKPGSLPGANDASRCAGGAPETQFSRYSEFVDTKT
GTLNFRNKAIIHSGGIDFTSGSSFNISLDEVDTLDELGKGNYGTVYKVRHCRPHLRRPGV
GLRGTVSRQTVAQSTSTPASSGPTSKNTSNVIMAMKEIRLELDEAKFTAIIMELDILHRC
VSPFIIDFYGAFFQEGAVYICVEYMDGGSVEKVYGDGIPENILRKITLSTIMGLKSLKDE
HNIIHRDVKPTNILMNTRGQIKICDFGVSGNLVASIAKTNIGCQSYMAPERIAGGGGTAG
GGTYSVQSDIWSLGLTVVECAMGRYPYPPETFNNIFSQLNAIVHGDPPKLPEHGYSPEAK
DFVQRCLNKDASRRPTYSMLLRDPWLSCLMKPPEDNPPTKAEEECKAGIDNDNENVDDKD
ATTNNKKPHPSSLIETADEEVATWVLDALDRRARGVMGNQHRPALHAVALDAVPGTPMLD
GPSSLPSK
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggacggccatgacctccaggatgctgcgggcaatgatctccggaaacccccccaaaaa
tctcccttaatttcgcccattccgtcagccgatgctcaacctccaaccctacgtcgtgtc
ggtgacagcccctctataatgagcccttcctccactcctcttggccttatcaatgccgcc
cggaagccacctactgttcctcctacctctaccacacggtccagcggcttgcatcaggat
atccaggccaaaatgaaggcattttcactttccagacaaggtgctcgtccagggctgagc
ccgcaatcatcttcaaccgccaatcctggtaccggaaaccctacagtgacttctgcggtc
cagggcggcccgtttgtcggtggcattcctcccaccagtggccgaggcactcctcaggta
gttggtggccctattccaccgggaatcggcagattaccgtcacagacatcccctgggtgg
acaccgcatccacctagtccaaatccaaatagcccaatacaaccaaagatgggtggtttg
gctgcgaaaagaggattaacccgtggaatgaagttatccgatgcttcgggccctcgaatg
gacaaacccacgccggcgaaaccgggaagtctccccggtgcgaacgatgcctcgcggtgc
gctggaggagccccagagacgcagttcagcaggtactcagagtttgtggatacgaaaacg
ggtactctgaattttaggaacaaggcgattatacatagcggtggcatagactttacctcg
ggaagcagtttcaacatatctctagacgaagtcgatacgcttgatgaactgggaaaaggg
aactacggcaccgtctataaggttcgccactgtcgtccgcatctgcgaagacctggcgtg
ggactgcggggtaccgtatccaggcaaactgtggcccaatccacttctacgccagcctct
agcggtcccacctctaagaatacctccaacgttatcatggccatgaaggagatccgcctc
gaattggatgaggcaaaatttaccgctattattatggagcttgacatccttcaccgctgt
gtatcgccgtttatcattgatttctacggtgctttttttcaggaaggtgcagtgtacatt
tgtgtggaatacatggatggtgggtctgtggagaaagtgtacggcgatgggatccccgag
aatatacttcggaaaatcaccctttctactatcatgggcttgaagtcattgaaagatgaa
cacaatatcatccaccgagatgtcaagccgactaacattttaatgaacacgcgcggtcag
attaagatttgcgactttggtgttagtgggaacctggtggcgagtatcgcgaagacaaac
atcggctgccaaagttatatggctcccgaacggattgcaggaggtggcggcaccgcaggc
ggtggaacctacagtgtgcagagtgatatatggagtttgggcctgactgtggttgaatgt
gctatgggccgctatccatatccccctgaaacattcaataacatatttagccagttgaac
gccatcgtccacggcgaccctcccaagctccctgaacacggctactcgcctgaagccaaa
gatttcgtccagagatgtctgaacaaagacgcgtcccgccgacccacatactccatgctc
cttcgcgacccttggctatcctgcctcatgaagccgcctgaggacaatccaccaaccaag
gccgaagaagaatgcaaggcaggcatcgacaacgacaacgaaaatgtcgacgataaagac
gcaactaccaacaacaaaaagccacatccgtcttctctcattgaaacagccgatgaggaa
gtcgccacatgggttttggacgcgctggaccgccgtgcaagaggcgtcatgggaaatcag
caccggccggcgttgcatgctgtggcgcttgatgctgtgccggggaccccgatgttggac
ggcccgtcatcgttgccatcgaaatga

DBGET integrated database retrieval system