KEGG   Ajellomyces capsulatus: HCAG_02470Help
Entry
HCAG_02470        CDS       T02229                                 

Definition
longevity-assurance protein 1
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
aje  Ajellomyces capsulatus
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    HCAG_02470
Enzymes [BR:aje01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     HCAG_02470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 447 aa AA seqDB search
MNSHSPSPEAPSVRHTQRGASERSGKSHSKRRRARSFFRRWKDTSLKHTWLTPLILLLII
LAAYSVNPTESNPVHSAIFLSYPNPPETPGGPIMYGKGKKDLAFVGFYTIVLSFTREFIM
QRIIRPWGVYCGIKSKAKMARFMEQVYTAIYFAVFGPFGLYVMSKTDIWYFNTTPMFEGF
PHRLHTADFKAYYLLEASYWAQQAIVLLLLLEKPRKDFKELVAHHIITLALIGLSYRFHF
TYIGLAVYITHDISDFFLATSKTLNYLDSVLIGPYFITFIGVWIYMRHYLNLRILWAVLT
EFQTVGPFELNWETQQYKCRLSQVITFGLLSALQAVNLLWLFLILRIAKNYVLSDVRKDE
RSEDEEEEEQEEDQQPTLTKDAQVCGNAGTGTGAIGSANNGSADATHVTRRTAKTKENDA
VTGPRAIVDGATTVDSESAKPVLDYNN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaattctcattcgccatcccctgaagctccgtcggtacggcacacacagcgtggagcg
tctgaaaggagcggaaaatcacactccaagcggcgacgggcgcggtcattcttccggcga
tggaaagatacctctctcaaacatacgtggctaacaccacttatcctattgctcattatc
ctcgccgcatactcagtgaacccaacagaatccaacccagtccacagtgctatcttcctc
tcataccctaacccccctgaaactcctggcggccccatcatgtacggaaagggcaagaaa
gatctcgccttcgtcggtttctacacaattgttctctccttcacccgcgaattcatcatg
caacgaataatacgaccgtggggcgtatactgtgggatcaagagcaaggctaaaatggcc
cggtttatggaacaggtgtacacggcgatctactttgctgtgttcgggccctttgggctc
tacgtcatgagcaaaacggatatctggtactttaacacgacaccaatgtttgaagggttc
ccgcacaggctgcatacagcggacttcaaggcttattacttgctcgaggctagttactgg
gcgcaacaggcaatcgtgctgcttctgctgctggagaaacccaggaaggatttcaaggaa
ctagtcgcgcatcatattattaccctggcgcttattgggctcagttaccgctttcatttc
acctacattggtcttgcggtttatatcactcatgatatttcggacttcttccttgcgacc
tccaaaactctcaattacctggactccgtcctcatcggtccatacttcattacgtttata
ggcgtctggatatacatgcgccattaccttaatctccgcatcctctgggcagttcttacg
gaattccaaaccgtcggtccctttgaactcaattgggaaacccaacagtacaaatgtcgt
ctcagccaagttatcacttttggcctgctcagcgcactacaagccgtcaacctgttatgg
ctgttcctgatcctccgcattgcaaagaactacgtcttgagcgacgtgaggaaggacgag
cggagtgaggacgaagaagaagaggagcaggaagaggatcagcagcccacgcttaccaaa
gatgctcaagtttgcggcaatgctgggactgggactggagccattggctctgcgaacaat
ggtagcgcggatgcaacgcatgttacgaggaggacagccaagactaaggaaaacgatgct
gtcacgggcccgagagctatagttgatggagctacgacggttgactctgaatcggccaag
ccggtgctggactacaacaattaa

DBGET integrated database retrieval system