KEGG   Ajellomyces capsulatus: HCAG_02511Help
Entry
HCAG_02511        CDS       T02229                                 

Definition
similar to triose phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aje  Ajellomyces capsulatus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:aje01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:aje01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aje00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:aje00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:aje00562]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 91 aa AA seqDB search
MLMAFSFNSYRAIGTGKVATTEQAQEVHASIRKWLGDKISTDTAENVRVIYGGSVTEKNC
RDLAQQPDVDGFLVGGASLKPAFIDIINSRL
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgctgatggcattttctttcaattcctacagggctattggaacgggcaaggttgctacc
acggaacaggcacaggaagtccatgcttcgatccgcaagtggctgggtgacaagatctcc
accgataccgcagagaatgtccgtgtgatctatggaggaagcgttacggaaaagaactgc
agggatctggcacagcagccggatgttgatggattcttggttggaggggctagcttgaag
ccagccttcatcgatatcatcaactcccgcctataa

DBGET integrated database retrieval system