KEGG   Ajellomyces capsulatus: HCAG_02511Help
Entry
HCAG_02511        CDS       T02229                                 

Definition
similar to triose phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aje  Ajellomyces capsulatus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HCAG_02511
   01230 Biosynthesis of amino acids
    HCAG_02511
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HCAG_02511
   00051 Fructose and mannose metabolism
    HCAG_02511
   00562 Inositol phosphate metabolism
    HCAG_02511
Enzymes [BR:aje01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HCAG_02511
Exosome [BR:aje04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HCAG_02511
  Exosomal proteins of bladder cancer cells
   HCAG_02511
  Exosomal proteins of melanoma cells
   HCAG_02511
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 91 aa AA seqDB search
MLMAFSFNSYRAIGTGKVATTEQAQEVHASIRKWLGDKISTDTAENVRVIYGGSVTEKNC
RDLAQQPDVDGFLVGGASLKPAFIDIINSRL
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgctgatggcattttctttcaattcctacagggctattggaacgggcaaggttgctacc
acggaacaggcacaggaagtccatgcttcgatccgcaagtggctgggtgacaagatctcc
accgataccgcagagaatgtccgtgtgatctatggaggaagcgttacggaaaagaactgc
agggatctggcacagcagccggatgttgatggattcttggttggaggggctagcttgaag
ccagccttcatcgatatcatcaactcccgcctataa

DBGET integrated database retrieval system