KEGG   Ajellomyces capsulatus: HCAG_02556Help
Entry
HCAG_02556        CDS       T02229                                 

Definition
similar to cullin
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
aje  Ajellomyces capsulatus
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:aje00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    HCAG_02556
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2249 aa AA seqDB search
MQEFVAKILEIQNGPLRNASLFARKCMDSMADIEKWLVRLGDLAQKASIVGQTQESDIEI
IEYQRSSLGKEHESIGAILCYLFKGTFTSSEDFRLLLDRLRKLDKFDMSLVHYIPAIILS
VSQYGSPEGSGSLRDARSLHQAIVPSKDPQDWVLAQFHAATMAFWLAEYADLSKLFITAL
DDGALEFMLQVCSGVSQNEWRDPGRIEMVNLLLKDSTPLTVEPDSSSPYFYALLMEHFEI
FIESLIANMPDAIRTLKSEEDIQRLDQITALREGLTSNLHRGPIETRMHFETLLMIMAFA
FEHRAEASQAFWTDPEGNLNGFLQWASKRQTVPRASAFCEMLCSISEGEENSLSAHKFLL
DEDNISSTKFRRSASMSWIQMIDELQLYATKATERPSAAPPSVFRIRKLEPADIDEPESP
VMLTSYLRLISHLCKQNSEIREWILQHPTLNLVNILLTLCDAPIPGHLRSSIFVTLRFLM
VDRTSLHGNDMWIALDQWISGSGSQTSPIAKISLPTNSPGWNERHAFQKITETFDQTFSF
VELLDTLASPPIDLANSQLSLPFPEPLGSSYRMPGIEPYIDFVIGQALVTRSVDIQEHQI
RHLQLACFNFIVTCLENFNENLISIVSEHFVPLDSGMRSSSLNTYIRLHPFARVMEWLFN
EDVLKAIFAAAHQNIDDVARATSDSIILRSLLRSIDVMNLIMDYQSTYFDVVRPLTKSQS
RQSTTNVANSSLTSFEDSVVNNLHIVTDLCLYCGTGHPQLTLTSLALLEKLSSSRKLNKA
TSSTLSRWQASNQIVELLNTDVEADRIARSLASQMKPDIRELESGPESSGYLIKLGLVNL
LDRCLSINPEKPNMAHLLLGFSCLGKTLDVAVGSLFQDQMSLLHAIIEFAQSYPDGVDGT
IFAWMVHLKEASFRVLRYLWSSKLSSTLVLPELRYSRLLVSLFATQPPVGPETLWNHFQT
SDPEFWYSESPAALSGFLNYRSMLFDYAVTEIRSVSSHGAPSLQRDTLSTLLGSSVDENN
RTFNHASFLDLFDFADLDIESIKPPPNLKFYNDVNLEPYTKTQGDGSLVLYDLATVKEFL
DFTRQDLLQAGVATAQDEEQLLSERDNVLLFLHANNQSRRIRLNRYSAVQSWAELATTII
VTCEMDSGQRSMLILHILQVILPKLESSIVDTAAEAIELGRLAESLLEKLGSSPSTQIPN
KGADIIDERLYHLFQACLRGIPLALENSPLRECLYNICSQYLSRITRDGSKHKRFGNHSE
QVVKSSGSSLVEVSSSLLIDMIAQSNYLAMFVDVVGAIPSEFRNAPASETSRLLVYYDAH
LSLLQQLSQSRIGAERILDAGLFQAVKESQLFATDPDIGIDIGNPDALRKYYDLLLAVMR
VIVSAVFARGLHNKQLLDQTRTFLSGNRQIMVGIFKRYAKVGGLDGGEVSETLEDLVKSY
VALIDAVGFLQIIGVTTNSIRPAPRGGNKSVGKRKHPEQEPEIREDQSPKQTTITDLFEN
GGNNISKNGRGELLPPSTKRVRRDISHPTSSLSTSDPTHQPISVEKMYTFPQNNTDSKSP
TGGTGLNSSPKSNGAPRQAGSRAFNYMTRPSSFTPHTGAKKLVVKNLRAIPRLDQDRYLE
KVWSQLDSALTAVLADQKPEQSLEELYRGAENVIIRSIFYYLDQSFLLHSADNPVIYEMG
LIQFRTTIFSNDILRPRILQGACQLIELDRAEDNTVVDPNLLKRAIKLFHDLGVYKKHVE
PCMLDASEIYISRWAVSEHTNILIKEDDIVDLLSKNDKFALEQLYSLLQRQDLGAKVKPA
FSAYIIKEGSAIVFDQENEDKMVTRLLKFKENLDEIWKSAFHKNETLGHSLREAFEKFIN
ETKQTGSNWGTDNPKPGEMIAKYVDMLLRGGVKAIQGLAEESKSGSTALVDEDAEINQKL
DQVLDLFRFVHGKAVFEAFYKNDLARRLLMGRSASDEAEKSMLARLRSECGSNFTHNLES
MFKDMDLARDEMASYNALLGPNRDRSNMDLNVNVISAAAWPSYPDVQLKIPKVISSAMDS
FEQFYNNKYNGRKLHWKHSLAHCQLKAKFPNGNKEIVVSSFQAVVLLLFNDVEDDTTLSY
PEIKEATGLSDIELKRTLQSLACAKYRVLTKRPKGRDVNDDDTFSFNSNFSDPKMRIKIN
QIQLKETKQENKTTHERVAADRHYETQAAIVRIMKARKVITHAELLVEVINKTKSRGVLE
PAGIKTNIEKLIEKDYIEREEGNKYRYLV
NT seq 6750 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaatttgttgcaaaaatcctcgaaatccaaaacggcccattgcgaaatgcgtca
ctcttcgctagaaaatgtatggattctatggccgatatcgaaaagtggctggttcgtttg
ggcgatctagcccagaaggcgtcaattgttggacaaactcaggaatcagatattgaaatc
atagaatatcagcgcagcagccttggaaaggaacatgagtcgattggcgcaatcctctgc
tatcttttcaaaggaactttcacgagctctgaagatttccgccttcttctggaccgactc
aggaaattagataagttcgacatgagcttggttcattatatcccagcaataatcttgtca
gtatctcagtatggctcccctgaaggttccggatcccttcgtgatgcaagatccctccac
caggctattgtaccttccaaagatccccaggactgggttctggcacaatttcatgctgct
accatggcattctggcttgctgaatatgctgatctctccaagttatttatcacggcactg
gacgatggggcccttgagttcatgctgcaggtctgcagtggggtcagtcagaacgagtgg
cgcgacccaggaagaattgagatggttaacctactcctcaaggatagtacacctttgaca
gtggagccagactcttcttctccatatttttatgcattgctcatggaacatttcgagata
tttatagaatctcttattgccaatatgccagatgccatcagaacactgaagtcagaggaa
gacattcagcgtttggaccaaataacggctctgcgggaaggtctaacctcaaacttacat
cgtggtcccattgaaacacgtatgcatttcgaaacattgcttatgataatggcatttgca
tttgaacatagggctgaggcttcccaggcattctggacagatccggagggaaatttaaat
ggatttctccaatgggcgtcgaagcgtcagaccgttcctcgggccagcgccttctgcgag
atgctttgctccatctcagaaggggaggaaaattctttatccgcgcacaaattcctctta
gatgaagataacatatcctccacgaaatttaggagatctgcttcgatgagctggattcag
atgattgatgaactccaactctatgctactaaggctacggaacggccttcagcggcacct
ccatcagttttccgtattcgaaaactagagccggctgatatagatgaacctgaaagcccg
gtgatgctcacttcatatctgagactcattagtcacttgtgtaaacagaactcggaaatc
cgggaatggattcttcaacacccaacactgaaccttgtcaacattcttctaaccctatgc
gacgcccccattccaggtcatctgagatccagcatatttgtcactttacggtttctaatg
gtcgacaggacctcgctccatggaaacgatatgtggattgcgcttgatcaatggatttcc
ggttcggggtcccaaacttcacctatcgctaaaatctctcttccgaccaattcccccgga
tggaatgaacggcatgcctttcagaaaataacagaaaccttcgatcaaacattttccttt
gttgaactactagatacgctagcatctccaccaatagatttggcaaattcacagctctcc
cttccatttcctgagccattagggtcttcatatcgaatgccaggcatagagccttatatt
gacttcgtcattggtcaagcacttgttactagatctgtcgacatccaggagcaccagatt
cgccacctccaattagcttgtttcaactttattgtgacatgtcttgagaatttcaacgaa
aacctcatatccatcgtaagcgaacatttcgttccgctcgattctggtatgcggtcctca
tccctgaacacgtacattagattgcatccatttgcgagagtgatggagtggctatttaac
gaggatgtccttaaggctatatttgccgctgcccatcaaaatattgacgatgtggcaagg
gccacgtcggattcaattatccttcgatctctgctccggagtattgacgttatgaatctc
attatggactaccaatcgacttattttgatgtcgtacgcccattaactaaatctcaatct
aggcaatccacaactaacgtggctaactcctcccttacatcgttcgaagacagtgtcgtt
aacaatcttcatatagtcacggatttgtgtctctattgcggtactggccacccgcagcta
actctcacttcgctcgcacttttggaaaaattatcaagctcgcgcaagttaaacaaggct
acttcatccacgttatctcgttggcaggcgtcaaatcagatagtagagttattgaacacc
gatgtcgaggcggatcgtattgctcgttctcttgcgtcacaaatgaagcctgatatacgt
gagctagagagcggacccgaatcttccggttaccttatcaagttaggacttgtaaactta
ctcgaccggtgtcttagtatcaaccctgaaaagccaaatatggcacacttacttctaggg
ttttcttgccttggaaaaacgcttgatgtcgcagtaggaagtttgttccaggaccaaatg
tcgcttttgcatgcaatcatcgaatttgcccagagctaccctgatggggtagatggaacc
atatttgcttggatggtgcatcttaaagaagcgagtttccgggtgcttcgatatctctgg
tcttcgaagctgtcgtcaactctcgttcttccagaacttcgttacagtcgtctccttgtt
tctctcttcgcaactcaacctccagtaggcccagagacactttggaatcatttccaaact
tctgatccagaattttggtattcggagtcacccgctgccttatcaggattccttaactat
cgaagcatgctctttgactatgccgtcaccgaaattcgctctgtttcgagccacggtgcc
ccttctttgcaaagggataccctttccaccttgctgggaagctccgtcgatgaaaataac
cgaacttttaaccacgcctccttcctcgacctctttgacttcgcagatttggacatagaa
tccataaaaccgccacccaatttgaaattctataatgatgttaacctggagccatatacc
aagacccagggcgatggttctttggtcctttatgatcttgctacagtgaaagagtttctt
gacttcactagacaagatttactacaggccggagtggcgaccgctcaagatgaagagcag
ctcttgtctgagcgagacaacgtattactatttctccatgccaataaccaaagtagaaga
attcgactcaatcggtactcggctgtccaatcctgggccgaacttgcaaccacgatcatt
gttacatgcgagatggactcaggacaaaggtcgatgttgattttgcatatcttgcaggtt
attctccccaaactcgaaagttccatcgtagatactgctgcagaggccattgagttaggc
cgtttggcagaatcattgctggagaagcttggttctagtccttccacccaaatccccaac
aaaggagctgacatcatcgatgaacgactctaccatctcttccaagcatgtcttcgtggg
atcccgctggccctcgaaaatagtcccttgagagaatgtctttacaacatttgttcgcaa
tatctttcgcgcattacgcgggatggatctaaacacaagcgctttggaaaccactcggaa
caagttgtcaagtcttcgggttcatcacttgtggaagtttcgtcatcgttgctcatagat
atgattgcccaatcgaactatctggccatgttcgtggatgttgtcggggcgataccctca
gagttccgcaatgcaccggccagtgaaacctcacgcctattggtttactatgatgcacat
ctgtcgctacttcaacaactttctcaatcacgaatcggcgcggagcgcatattagatgcg
ggtttgttccaagctgttaaggagtcccagctttttgctactgaccctgatatcggaatc
gacatcggcaacccagacgctcttcggaaatactatgacctgctccttgctgtaatgcgt
gtaattgtatctgcagtttttgcgcgtggcttgcacaacaagcaattacttgaccagacg
cgtacttttctttcaggaaatcgacaaatcatggttggaatatttaagcgatatgcaaaa
gttggtgggctggatggaggggaggttagtgagactctggaggatctagttaaatcgtat
gtcgctctgattgatgcggttggatttcttcaaataattggcgttacgactaattcaatt
agacctgcaccgaggggcgggaacaagtctgttggcaagcgaaaacacccggaacaagag
cctgaaatccgcgaggatcaatccccgaaacagacgactattacggacctttttgaaaac
ggcgggaataacatatcaaaaaacggtagaggggagcttctcccacctagcacaaagcga
gtgaggcgagatatatcccatcccacaagctccctctcaacctccgaccccacccaccaa
cccatttcagttgagaaaatgtacacattcccacagaacaataccgattcgaaatcaccg
actggtggaactggattgaattcgtcaccgaaatcaaacggtgccccccgtcaggccgga
tcgcgcgcgttcaattacatgacaagacccagcagcttcacgccacatacaggagctaag
aagctcgttgtcaaaaatctacgagccataccacgtttggatcaggatcgatatttagaa
aaggtctggtcgcagctggactcggctctgacagcagtcctggcagatcagaagccagaa
cagtcgcttgaggagctatacagaggcgctgaaaatgttataattcgttccattttctat
tacttagaccaatcattcctgttacattcggcggacaatccagtcatttacgagatgggc
ttaatccaattccgcacgacgatcttctccaacgatatattacgacctcgaatcttgcaa
ggagcctgccaactcattgaacttgacagggcggaagacaatacggtggtcgacccaaat
ttactcaaacgtgccatcaaactatttcatgacctgggtgtctacaagaagcatgttgaa
ccgtgcatgcttgacgcatcggaaatatacatcagtagatgggctgtttctgaacacacc
aatatcctaattaaagaagacgatatagttgatctacttagcaagaacgacaaatttgct
ctggaacaattatactctttgctacaacgacaggacctaggggccaaagtgaaaccggca
ttctccgcgtatattatcaaagaaggctctgctatcgtattcgatcaggagaatgaagac
aagatggttaccagacttttgaagttcaaggagaatttggatgaaatatggaagagcgca
tttcacaaaaatgaaaccctaggtcatagtcttcgggaggctttcgaaaaatttatcaat
gaaacgaaacaaacagggtcgaattggggtaccgataatccaaagcccggtgagatgatt
gcgaaatacgttgatatgctacttagaggaggtgtcaaggccattcagggtctggctgaa
gaatcaaaaagcgggagcacggcattagttgatgaggatgcggaaatcaaccagaaattg
gaccaggttttggatcttttccgttttgtccatggaaaagctgttttcgaagccttctac
aaaaacgatctcgcccgtcgcctacttatgggtagaagcgctagtgatgaggccgaaaag
agcatgcttgcaaggctcaggtcagaatgtggatcgaattttactcataacctcgagtcc
atgtttaaggacatggatcttgcgcgtgatgaaatggcatcgtataatgcgcttctcggc
ccaaaccgagatagatccaatatggatctgaacgtaaacgtcatatcagcggctgcatgg
ccatcatacccagatgtccaattgaaaataccaaaggttatatccagcgcgatggacagt
ttcgaacagttctacaataacaagtacaatggtagaaaacttcattggaaacactctctt
gcgcactgtcaactcaaggcaaagtttccaaatgggaataaggaaatcgttgtcagctcc
ttccaagccgttgtccttctccttttcaacgatgtggaggatgataccactttgtcatat
ccagaaatcaaggaggctacgggcttgtctgatatcgaattgaaacgaactctccaatcg
ctagcctgcgccaaataccgtgtcttgaccaagcgtccaaagggccgagacgtcaatgac
gacgacacattttctttcaactcaaacttctcagaccccaagatgcgcatcaagatcaac
cagatccagctcaaggagaccaaacaagagaacaagactacgcacgaacgtgtagcagcg
gaccgacactatgagacgcaggcagccatcgttcgaattatgaaggcgcgtaaggtcatc
actcatgcggagctattggtggaagtgattaataaaacgaagagcagaggtgtactagag
cctgcggggatcaagactaatattgaaaaactcatcgaaaaagattatatagaaagggaa
gagggaaacaagtatcgatacctagtttga

DBGET integrated database retrieval system